(data stored in ACNUC7421 zone)

EMBL: AP010803.PE376

AP010803.PE376       Location/Qualifiers
FT   CDS_pept        complement(385103..385363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95210"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX8"
FT                   /protein_id="BAI95210.1"
FT                   /translation="MPKTASLTTFFDLFAPTIFRRSLHLIATIFFLVMPSSMRGPPGKP
FT                   VTLPRHSEGNFVSQVLTVRRAIPADSKGQSRQRMQENFQLS"
     atgcccaaaa ccgcctcttt gacaactttt ttcgatctat tcgcgcctac catattccgc        60
     cgcagtctgc acctgatcgc aaccatattt tttttggtga tgccctcgtc tatgcgtggt       120
     cccccgggga agcctgtgac ccttcctcgc cactcggagg gcaattttgt ttctcaggtt       180
     ctgaccgtcc ggcgcgcaat tccagccgat tccaaaggcc agtctcggca aaggatgcag       240
     gaaaacttcc aactctcatg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page