(data stored in SCRATCH zone)

EMBL: AP010803.PE377

AP010803.PE377       Location/Qualifiers
FT   CDS_pept        complement(385607..386959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03770"
FT                   /product="putative iron uptake protein"
FT                   /note="uncharacterized iron-regulated membrane protein /
FT                   PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95211"
FT                   /db_xref="GOA:D4YXX9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX9"
FT                   /protein_id="BAI95211.1"
FT                   /translation="MTTIAPESSTVKRALSAHAAIGLLAGALLYIVSLSGTLAVFYQEF
FT                   QRIEQPRAPEMASIDPQAVQRGIEAVLAREKGKPLATHLYVHLPVEGLPRTVITTDTQA
FT                   VHIDRTGKIAGKEEIAWSDFLAQLHYMLNIPGLFGFILVGILGVMMLTLSLSGVIAHPR
FT                   IFRDAFRLRARDKGGLGLADWHNRMSVWTLPFILAISLTGALIGTADLTAYGIGATGYK
FT                   GDMEAVYASIFGPEGKPDTKAAPAPNIAAALDYMAAHYPGRRLTYVTLHDPLTAGQHVQ
FT                   IVGTFERRLVFGEYYNFDAAGRVIGRAGISDGPAGRQMAASNYNLHFGNFGGLPVKMAY
FT                   FILGMALTAICATGTYIWLGKRERRGIGAPRIRAAWDAVVWGAPLILALAFVLRKTLGN
FT                   DLPLVAIFWGGLAAILVGAWFFAAPGQIAKLLKRALVLACGLGSALALAGF"
     atgacgacca tcgcccctga aagctcgaca gtgaagcgcg ctctttcggc gcatgccgcc        60
     atcggcctgc tcgccggcgc gctgctctat atcgtcagcc tctccggcac gctcgctgtc       120
     ttctaccagg agtttcagcg cattgagcag cccagggcgc cggaaatggc gtcgatcgat       180
     ccgcaggcgg tgcaacgcgg catcgaggcg gtgctcgctc gcgagaaagg caagccgctt       240
     gccacccatc tctatgtcca ccttcccgtg gaagggctgc cgcgcacggt catcaccacc       300
     gacacgcagg ccgtgcatat cgacaggacc ggcaagatcg cgggcaagga ggagatcgcc       360
     tggtccgact tcctcgccca gctccactat atgctcaaca ttccgggcct gttcggcttc       420
     atcctggtcg gcattctggg cgtcatgatg ctgacgctct cgctctccgg cgtgatcgcc       480
     catccccgca tcttccgcga cgctttccgc ctgcgcgccc gcgacaaggg gggccttggc       540
     cttgccgact ggcacaaccg gatgagcgtc tggacgctgc ccttcatcct cgccatctcg       600
     ctcaccggcg cgctcatcgg cacggcagac ctcaccgcct atggcattgg cgcaacgggc       660
     tacaagggcg atatggaggc agtctatgcg tccatcttcg gccccgaggg caagcccgat       720
     accaaggcgg cgccagcgcc caatatcgcg gcggcgctcg actatatggc cgcacattat       780
     cccggccgac gcctcaccta tgtgacgctg cacgaccctc tgaccgccgg gcagcatgtt       840
     cagatcgtcg gcaccttcga acgcaggctg gtgttcggcg aatattataa tttcgacgcg       900
     gccggtcgcg tcatcggcag agccggcatc tccgacggtc ccgcaggccg gcagatggcc       960
     gcctccaact ataatctgca tttcggcaat ttcggcggcc tgccggtcaa gatggcctat      1020
     ttcatccttg gcatggcgct cacggccatc tgcgcgacgg gcacctatat ctggctgggc      1080
     aagcgcgagc ggcgtggcat cggggcgccg cgcatccgcg ccgcgtggga tgccgtggtc      1140
     tggggcgcgc cgctgatcct tgccctggca tttgtcctgc gcaagacgct gggcaacgac      1200
     ctgccgctgg tcgcgatctt ctggggaggt cttgccgcca tactggtcgg cgcatggttc      1260
     tttgcggcgc ccggacagat tgccaagctg ctcaagcgag cgcttgtgct ggcgtgcggc      1320
     ctgggttcgg ccctggccct cgccggtttt tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page