(data stored in ACNUC7421 zone)

EMBL: AP010803.PE378

AP010803.PE378       Location/Qualifiers
FT   CDS_pept        complement(386956..387534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95212"
FT                   /db_xref="GOA:D4YXY0"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY0"
FT                   /protein_id="BAI95212.1"
FT                   /translation="MADTLLILAGVSAACGSAALRHAWSLHRRSSLWNAAGWGLFLLGV
FT                   VTGWWGAGAWGVSVASLVGMSAALLILSHAAITSPAAGSAKASNRRVGMLPERGEPLHL
FT                   RRRLMTFLIVVILAMIVSTGLGIAAYGLMALTGAAEANSVVTGFFVTPLAWSILAYALL
FT                   IEERRIRQWATLGILAVPGALALIFGLSA"
     atggctgaca cgcttctgat cctcgcaggc gtcagcgcgg catgcgggag tgccgcgctg        60
     cgccatgcat ggtccctgca ccggcgctcc agcctgtgga atgccgcggg ctggggcttg       120
     ttcctgctcg gcgtcgtcac cggctggtgg ggagcgggcg cctggggcgt ctcggtcgcg       180
     tcgcttgtcg gcatgagcgc ggcgctgctg atcctcagcc atgccgccat cacgtcgccc       240
     gccgccggca gtgccaaggc ctcgaacagg cgtgtcggca tgctgcccga acgcggcgag       300
     ccgctccatc tccggcggcg gctgatgacc ttcctgatcg tcgtcatctt ggcgatgatc       360
     gtctcgacag ggcttggcat cgccgcctat ggcctcatgg cgctgaccgg cgcggccgag       420
     gccaattccg tcgtgacggg cttcttcgtg acgccgcttg cctggtcgat cctcgcctat       480
     gcgctcctga tagaggagcg ccgcatccgc caatgggcga cgctcggcat cttggccgtg       540
     ccgggggcgc tggctctgat atttggattg tccgcatga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page