(data stored in SCRATCH zone)

EMBL: AP010803.PE379

AP010803.PE379       Location/Qualifiers
FT   CDS_pept        complement(387534..389711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03790"
FT                   /product="outer membrane receptor for ferric iron uptake"
FT                   /note="iron complex outermembrane recepter protein / outer
FT                   membrane receptor for ferric coprogen and
FT                   ferric-rhodotorulic acid / outer membrane receptor protein,
FT                   mostly Fe transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95213"
FT                   /db_xref="GOA:D4YXY1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY1"
FT                   /protein_id="BAI95213.1"
FT                   /translation="MKSIKSLLLGSVAMSFCAAAQAQEAAPGSDDQGAIVVTGTYTLDH
FT                   SIDTATGLGLALRETPQSVSVMTAQRILDQNLITVKDVIQNGVGVAVNEVDDVRNSFYA
FT                   RGFEIRNTQIDGVPAAWTLAGANGETSADVSIYERVEIVRGATGFLSGAGDPSASVNLV
FT                   RKHADFADFKGYLNAGVGSWDSWRLSADLGGALTPDGRVRARVVGRYERGKSYIDIQDR
FT                   KKWVLYGVVEADVTDSTLVRVGISHQDTKPSGATWGALPTFYSDGTTTFLPRSQTTAAD
FT                   WTYWNTTNQNIFATVRQAFGERWSLTVNYNRLKNSGDTQLLYLYGNVNKATGTIDSSNP
FT                   YKSTGESVQESFDGQLKGEVSLFGRDHEVVLGALHSILNRHTDNFVAPYTRNNPAWGAG
FT                   LNDWANNVPLVGEVGVPFPEPVWGTTPVRNEQERIKQTGYYAAVRLNIADPFKAVVGGR
FT                   LASWHQTGFAWSGPSDYGNDDVFIPYVGALLDVAPNHRLYASYTRIFQPQNLLDRNLRQ
FT                   LDPLNGNAFEIGVKSSFFGDKFQTSIALFQIKQDNVGQPDIMVTPPGGGLPQQTYVAAE
FT                   GITSKGVELEATGQLLPGWNVNASYSRFWADYSNGAPANTDQPRKLLKVFTTYSFPVLG
FT                   RDLTLGGGVNYRGVAYSTGANPVTLAPFRFTQGAYTLVSVMARYNITDQVEIQANVENL
FT                   LDKTYFSQVGFYSQYRYGAPRNFTVGATYRF"
     ttgaagtcga tcaagtcgtt gctgctgggc agcgtcgcca tgagcttttg cgcagccgcg        60
     caggcccagg aggctgcgcc gggcagcgat gaccagggcg ccatcgtcgt cacgggcacc       120
     tacacgctcg atcatagcat cgatacggcg accggccttg gcctcgccct gcgagagacg       180
     ccgcagtcgg tcagcgtcat gaccgcccag cgcatcctcg accagaacct gatcaccgtg       240
     aaggacgtga tccagaacgg ggtcggcgtg gcggtcaacg aagtcgatga cgtgcgcaac       300
     agcttctatg cgcgcggctt cgaaatccgc aatacgcaga tcgacggcgt gccggcggcc       360
     tggacgctgg ccggcgccaa tggcgagacg agcgccgacg tgtcgatcta cgagcgggtc       420
     gagatcgtgc gcggcgcgac cggcttcctc tcgggcgcgg gcgatccgtc cgcgtcggtc       480
     aacctcgtcc gcaagcatgc cgatttcgcg gacttcaagg gctatctcaa tgcgggcgtc       540
     ggcagttggg acagctggcg cctatcggcc gacctgggcg gcgcgctcac cccggacggc       600
     cgcgtccgcg cccgcgtcgt cggccgctac gagcggggga agagctatat cgacatccag       660
     gacaggaaga agtgggtgct ctacggcgtc gtcgaagccg atgtgaccga ttccacgctt       720
     gtccgtgtgg gcatctccca tcaggacact aagccgagcg gcgcgacctg gggcgctctg       780
     ccgaccttct acagcgacgg cacgacgaca tttctgcccc gctcgcagac cacggcggcg       840
     gactggacct attggaacac gaccaaccag aatatctttg cgaccgtgcg ccaggcgttc       900
     ggggagcgct ggagcctgac cgtcaattac aatcgcctga agaatagcgg cgacacgcaa       960
     cttctgtatc tctacggcaa tgtgaacaag gcgacgggga cgatcgattc ctccaatccc      1020
     tacaagtcga ccggcgaaag cgtccaggag agcttcgacg ggcagctcaa gggcgaggtc      1080
     tcgctgttcg gccgcgatca tgaagtcgtg ctgggggcgc tgcacagcat cctcaatcgc      1140
     cataccgaca attttgtggc gccctacact cggaacaacc cggcctgggg cgcaggattg      1200
     aacgactggg cgaacaatgt tccgctcgtg ggtgaggtcg gcgtgccctt cccagagccg      1260
     gtctggggca ccacgcccgt ccgcaacgag caggagcgca tcaaacagac cggctattat      1320
     gccgcggtcc gcctgaatat cgccgatccg ttcaaggccg tcgtcggcgg ccgtctggcg      1380
     agctggcatc agaccggctt cgcctggagc ggtcccagcg actatggcaa tgacgatgtg      1440
     ttcattccct atgtcggcgc cttgctggac gtggcgccga accaccgcct ctatgcaagc      1500
     tataccagga tcttccagcc gcagaacctg ctcgaccgca acctgcggca actcgacccg      1560
     ctgaacggca atgccttcga gatcggcgtg aagagcagct tcttcggcga caagttccag      1620
     acttccatcg cgctgttcca gatcaagcaa gacaatgtcg gccagcccga tatcatggtc      1680
     acgccgcccg gcggcggcct gccgcagcag acctatgtcg cggccgaggg catcaccagc      1740
     aagggcgtcg aacttgaagc gaccggccag ctgctgcccg gctggaacgt caacgcaagc      1800
     tatagccggt tctgggcgga ctacagcaat ggcgctccgg cgaacacgga ccagccgcgc      1860
     aaattgctca aggtcttcac cacctacagc tttccggtgc tcggccgcga cctgacgctt      1920
     ggcggcggcg tcaactatcg cggcgtggct tattcgaccg gcgccaaccc ggtcacgctt      1980
     gcgcccttcc ggttcacgca gggcgcctat acgctggtga gcgtgatggc gcgctacaac      2040
     atcaccgacc aggtcgaaat ccaggccaat gtcgagaacc tgctcgacaa gacctatttc      2100
     agccaagtcg gcttctatag ccaatatcgc tatggcgccc cgcggaactt cacggtcggc      2160
     gcgacctatc gcttctga                                                    2178
//

If you have problems or comments...

PBIL Back to PBIL home page