(data stored in ACNUC7421 zone)

EMBL: AP010803.PE384

AP010803.PE384       Location/Qualifiers
FT   CDS_pept        complement(395135..395929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03840"
FT                   /product="putative gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein / trans-2-enoyl-CoA reductase (NADPH) (EC
FT                   1.3.1.38)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95218"
FT                   /db_xref="GOA:D4YXY6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY6"
FT                   /protein_id="BAI95218.1"
FT                   /translation="MADWNPGFTAAQFRLDGKRALITGGRGALAEAMAATLADLGCAVA
FT                   LASRTEADCADLAAGIAERFRVPAIGLSCNIADEASVEAAVAGTVDRLGGLDILINNAG
FT                   ASWWGLPQDIPLKGWQKVMDVNVTGTFLACRHAARHMIAAGGGAIVNIASVGAFLSYQP
FT                   DAGQVVPYTTSKAAIVHLTSDLAAQWAGHNIRVNAIAPGSIETGMTETLDPAIQERTRA
FT                   GILMRRFGRPEEVAGTLALLASDAGSFITGQTFLVDGGQSLA"
     atggctgact ggaaccccgg tttcaccgcc gcgcaattcc gtctggacgg caagcgcgcg        60
     ctcataaccg gcggacgcgg cgcgctggcc gaagcgatgg ccgcgacgct ggcggacctg       120
     ggctgcgccg tcgccctcgc ctcccgcacg gaggccgact gcgccgatct ggcggccggc       180
     atagccgagc ggttccgggt tccggccatc ggcctttcct gcaacatcgc tgacgaggca       240
     tcggtggagg cggcggtcgc gggaacggtc gaccggctgg gcgggctcga catcctcatc       300
     aacaatgcag gcgcgtcctg gtggggactg ccgcaggaca tcccgctcaa gggctggcag       360
     aaggtgatgg acgtcaatgt gaccggcacc ttcctcgcct gccgccacgc cgcgcgccac       420
     atgatcgcgg cgggcggcgg cgccatcgtc aacatcgctt cggtgggcgc cttcctgtcc       480
     tatcagccgg acgcggggca ggtcgttccc tacacgacca gcaaggcggc gatcgtccac       540
     ctgacgagcg atctcgccgc ccaatgggcc gggcacaata tccgcgtcaa cgccatcgcg       600
     cccggatcga tcgagaccgg gatgaccgag acgctcgatc ccgccatcca ggaaaggacg       660
     cgggcgggca tattgatgcg ccgcttcggc cgcccggagg aggtggcggg cacgctcgcc       720
     ctgctggcgt cggacgcggg cagcttcatc acgggccaga ccttcctggt cgacggaggc       780
     caatcccttg cctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page