(data stored in ACNUC7421 zone)

EMBL: AP010803.PE385

AP010803.PE385       Location/Qualifiers
FT   CDS_pept        complement(395922..396260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95219"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY7"
FT                   /protein_id="BAI95219.1"
FT                   /translation="MAVSMVVLASRPRDWTQEQFTNWWRGPHADAARVLPGLIAYRHGA
FT                   VTKDYDNPEAPGWDGHAVLTFADQAALDAAFASPEWKAATAQTKGMGGRRIILITDEVD
FT                   LLAGDDHG"
     atggcggtca gcatggtcgt cctggccagc cggccgcggg actggacgca ggagcagttc        60
     accaactggt ggcgagggcc gcatgccgac gccgccaggg tgctgccggg gctgatagcc       120
     tatcggcacg gcgcggtgac gaaggattac gacaatcccg aagcgccggg ctgggacggg       180
     catgccgtgc tgaccttcgc cgaccaggcg gcgctcgacg ccgccttcgc ctcgcccgaa       240
     tggaaggcgg cgaccgccca gacgaagggc atgggcggtc ggcgcatcat cctcatcacc       300
     gatgaagtcg atctgcttgc cggagacgat catggctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page