(data stored in ACNUC7421 zone)

EMBL: AP010803.PE387

AP010803.PE387       Location/Qualifiers
FT   CDS_pept        complement(397104..397811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95221"
FT                   /db_xref="GOA:D4YXY9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY9"
FT                   /protein_id="BAI95221.1"
FT                   /translation="MTNSPLMEVALLRGYAPYTLAGYDIFRSVIESDGAVPARLKALFA
FT                   AVAAVDRRHLSLARRELERGVSLGLTSKEATAGLIVLSSLRGEAAALDFAQIIEESFGD
FT                   AQAPVPQPLPKAAEGEAEANFRAYWAGSIPAPLGALMRLAPEAADAYYLMRRGSIDANP
FT                   LSAKYGELLLLAILAAGYSPMAATHVRGARNAGASDEEIAEAVLCAIPSAGIAAWMAVG
FT                   GMLAPPEEGGIAR"
     atgacgaaca gcccactcat ggaagtcgcc ctgttgcggg gctatgcgcc gtacacgctt        60
     gcaggatatg acattttccg atcggtgatc gagtcggacg gcgcggtgcc ggctcgtctg       120
     aaagcgctgt tcgcagcggt ggctgccgtc gatcgccgcc atttgtccct ggcgcgccgg       180
     gaactggaac gcggcgtatc gcttggcctg acatcgaagg aggcgaccgc tggcctcatc       240
     gtgctgtcca gcctccgcgg cgaggctgcg gcgctcgatt tcgcgcagat catcgaggag       300
     agtttcggcg acgcccaggc gccggtcccg caacccctgc ccaaggcggc ggagggagag       360
     gcggaggcca atttccgggc ctattgggcg ggaagcatcc cggcgccgct cggcgcgttg       420
     atgcgcctgg cgcccgaagc ggcggacgcc tattatctca tgcggcgggg cagcatcgac       480
     gccaacccgc tgtccgccaa atatggcgaa ctgctcctgc tcgccatatt ggcggccgga       540
     tacagtccca tggccgcgac ccatgtgcgc ggcgcgcgca atgcaggcgc gagcgacgag       600
     gaaattgccg aagcagtgct gtgcgccatt ccgtcggcgg ggatcgccgc ctggatggcg       660
     gtgggcggca tgcttgcccc gcccgaagaa ggcggcatcg cccgctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page