(data stored in ACNUC7421 zone)

EMBL: AP010803.PE388

AP010803.PE388       Location/Qualifiers
FT   CDS_pept        complement(397808..397978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95222"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXZ0"
FT                   /protein_id="BAI95222.1"
FT                   /translation="MPPDSSRPAHVLILTRPIGRAISSRPTGRLSNWSGKKFLVDARPV
FT                   GRSSGSQESKR"
     atgccgccgg attcgagccg gcctgctcat gttctaatac tcacccgacc gatcggtcga        60
     gcgataagta gtcgaccgac tggtcggctg tcaaactggt cagggaagaa atttttggtt       120
     gacgcccgac cagtcggtcg atcatctggg tcgcaggaga gcaagcgatg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page