(data stored in ACNUC7421 zone)

EMBL: AP010803.PE391

AP010803.PE391       Location/Qualifiers
FT   CDS_pept        400377..403265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03910"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95225"
FT                   /db_xref="GOA:D4YXZ3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXZ3"
FT                   /protein_id="BAI95225.1"
FT                   /translation="MMTRFKIGRVALLSGCAFAGIIVPAHAQTAATATAEAQSAEDAGA
FT                   PSAQDIIVTGTRVVRDGYNQPTPVTVAPTTELEKATPTNLADAINKLPQFANSVSPQSN
FT                   SQLQGNSGEHGNLLNLRGVGPTRALILLDGIRVPPTTFRGAVDVNTIPQLLIQRVDVVT
FT                   GGASAVYGSDAVSGAVNFVLDKKFTGVKGVAQRGVSTRGDLGNYRIGIAGGMSFAGDRG
FT                   HVLASVERFHSDGIKRSARIYGDDAYAAVGSVPGSTAAPGREANPFIFLPNLRFTTNDY
FT                   NNGIITASTVPALVNTIFLPGGAVRPIQRGTPTGTPGTNVGGDGLYIPGFNQLIAPLTT
FT                   TQGFGRLAYDLTDGLTAHVQGSYSRSVTSYDTQAQSVLGFRFFSGNAFLDPAVQAQMGP
FT                   NDNFTVFRFIAEQGPIPTREATNAYLINGGLEWNLGGWNITADYTHGKSVTKFAQTQVE
FT                   IPKLAAALDAVRGPNGSIVCRVTLTNPGLYPGCTPLNVFGAGTPSAADLQTVLGVSRYR
FT                   AMNSTDDFVLSARGDVFELPAGPVTVAIGGQYRKQKLDLTSNSDPAVPIDFTGLRGIPA
FT                   NRMTRFNNTNVGSAFGKLNVKEVFAEAQVPIFKGQPLAEELSLNGAFRLTDYSTSGSVK
FT                   TWKVGAVYKPIEDVMFRVTRSRDIRAPSLFELFAGVQTAPVNFNDPHTGQPGSIRQFSG
FT                   GNPNLDPETGDTFAAGVVLSPSFLPGFDVSVDYYDLKIKGAIATQGLNDVVNECETSNG
FT                   TSPTCALIERPLPFSDRSPANYPISVSLITQNISFLRTSGLDIAMSYRTKLGDGELALR
FT                   AFANYLDRYKSQTNSIAPVIDYAGHGVNSQTGYAYPKFRGTLSANYTNGGLTLFVQESM
FT                   IGKVTIGNLKNDPTSFYAVPAIKPVFYTDATASYKFDVRGEPELFVTATNLFDRKPPLV
FT                   AAAAAPGLLYPTLFTLYNVAGRTLTAGVRFKF"
     atgatgacaa ggttcaagat tggccgagta gcgctccttt cgggatgcgc gtttgccggg        60
     atcatcgtgc cggcccatgc gcaaacggcg gcgacggcaa cggccgaagc gcagtcggcg       120
     gaggatgccg gcgcgccttc cgcgcaagac atcatcgtca ccggaacgcg cgtcgtgcgc       180
     gacggctata accagccgac gcccgtcacc gtcgcgccca ccacggaact ggagaaggcg       240
     acccccacca accttgccga cgcgatcaac aagttgccgc aattcgccaa ctccgtcagc       300
     ccgcaatcca acagccagtt gcagggcaat agcggcgagc atggcaatct gctcaacctg       360
     cgcggcgtcg gcccgacgcg ggcgctgatc ctgctcgacg gcatccgcgt gccgcccacg       420
     acattccgcg gcgcggtgga cgtcaacacg atcccgcaac tgctgatcca gcgggtcgac       480
     gtcgtgaccg gcggcgcatc cgccgtctac ggctccgacg ccgtcagcgg cgcggtgaac       540
     ttcgtcctcg acaagaagtt caccggggtg aagggcgtcg cgcagcgcgg cgtgtccacc       600
     cgcggcgacc ttggcaacta ccgcatcggc attgcggggg gcatgagctt tgcaggcgat       660
     cgcggccatg tcctcgcctc ggtcgagcgc tttcacagcg atggcatcaa gcgcagcgcg       720
     cgcatctacg gtgacgacgc ctatgcggcc gtgggttcgg tccccggatc gaccgccgcg       780
     ccaggccgcg aggcaaatcc gttcatcttc ctgccgaacc tgcgcttcac gacgaacgac       840
     tataataacg gcatcatcac ggcgagcacg gtgcccgcgc tcgtcaacac tatcttcctg       900
     cccggcggcg cggtgcgtcc gatacagcgc ggcacgccga ccggcacgcc gggcaccaat       960
     gtgggcggcg acggcctcta cattcccggc ttcaaccagt tgatcgcgcc gctgacgacg      1020
     acccagggct ttggccggct ggcctacgac ctgaccgatg ggctgacggc gcatgtccag      1080
     ggcagctact cgcgcagcgt caccagctat gacacgcagg cccagtccgt gctgggtttc      1140
     cgcttcttca gcggcaacgc cttcctggac ccggcggtcc aggcgcaaat ggggccgaat      1200
     gacaacttca ccgtcttccg cttcatcgcc gagcagggac cgatcccgac gcgggaggcg      1260
     accaacgcct atctcatcaa cggcggcctt gagtggaacc tgggcggatg gaacatcact      1320
     gccgactata cccatggcaa gtccgtcacc aaattcgccc agacgcaggt cgagattccg      1380
     aagctggcag cggcgctgga cgcggttcgc ggacctaacg gttcgatcgt ctgccgcgtc      1440
     acgctgacca accccggcct ctatccgggg tgcacgccgc tcaatgtctt cggcgcggga      1500
     acgccctccg ccgccgatct gcaaaccgtg ctcggcgtat cccgctaccg cgccatgaac      1560
     tcgaccgacg acttcgtcct gtcggcgcgc ggggacgttt tcgagcttcc ggcaggcccg      1620
     gtcacggtcg ccattggcgg gcaatatcgc aagcagaagc tggacctgac gtccaattcc      1680
     gatcccgccg tgcccatcga cttcaccggg ttgcggggca ttccggccaa tcgcatgacc      1740
     cgcttcaaca acaccaatgt cggctcggcc ttcggcaagc tgaacgtgaa ggaggtgttt      1800
     gccgaagcgc aggttccgat attcaagggc cagccccttg ccgaggaact gagcctcaac      1860
     ggcgctttcc gcctcaccga ctacagcacc agcggaagcg tcaagacctg gaaggtcggc      1920
     gcggtctaca agccgattga ggacgtgatg ttccgcgtca cgcgctcgcg cgatattcgc      1980
     gcgccctcgc tgttcgaact gttcgcgggc gttcagaccg cgccggtgaa cttcaacgac      2040
     cctcacacgg gccagccggg ttcgatccgt caattcagcg gcggcaatcc caacctcgat      2100
     cccgaaaccg gcgacacgtt cgccgcgggc gtggtcctca gccccagttt cctgcccggc      2160
     ttcgacgttt cggtcgatta ttacgacctc aagatcaagg gcgccatcgc cacgcagggg      2220
     ctgaacgatg tcgtcaacga gtgcgaaacg tcgaacggca cgtcgccgac atgcgctctt      2280
     atcgaaaggc cgctgccgtt cagcgatcgc tcacccgcca actatccgat ttcggtgagc      2340
     ctcatcacgc agaacatcag tttcctgcgc accagcggcc tcgacatcgc catgtcgtac      2400
     cggaccaagc tgggcgatgg cgaactcgcg ctgcgcgcct tcgccaacta tctggatcgc      2460
     tacaagtctc agaccaattc catcgcgccg gtgatcgatt atgccggcca tggcgtcaac      2520
     agccagacgg gctatgccta tcccaagttc aggggcacgc tcagcgccaa ttacaccaat      2580
     ggcggcctga cgctgttcgt gcaggaatcg atgatcggca aggtgaccat cggcaacctc      2640
     aagaacgatc cgacgtcctt ttatgctgtc ccggcgatca agccggtctt ctataccgac      2700
     gccacggcat cctataagtt cgacgtgcgc ggggagccgg agctgttcgt gacagccacc      2760
     aacctgttcg accgcaagcc gccgctggtg gccgcggccg ccgcgccggg ccttctctat      2820
     ccgacgctgt tcacgctcta caacgtcgca gggcgcacgc tcacggcggg ggttcgtttc      2880
     aaattctga                                                              2889
//

If you have problems or comments...

PBIL Back to PBIL home page