(data stored in SCRATCH zone)

EMBL: AP010803.PE393

AP010803.PE393       Location/Qualifiers
FT   CDS_pept        complement(404671..405417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03930"
FT                   /product="LinC-like dehydrogenase"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95227"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXZ5"
FT                   /protein_id="BAI95227.1"
FT                   /translation="MATKGRVEGKVVLITGAAHGLGKADAEALAREGARVIVADVDEEE
FT                   AQRVVDMLPAAMALRLDVTCEAQWQAALTKIMQAYGRLDGLVNNAGIAAFETVEQSSLE
FT                   AFRRVMAVSAEGTFLGCKTCLPALAASGAGSIVNIASVAAIRGNPAVFAYSAAKGAVLS
FT                   MTRSLIVHCQQQGYPVRANVVLPGSHDTQMVREAYRFAAPELREAARKHEGQPEHVADL
FT                   VLFLVSDESARLNGAEIVIDNGRTVG"
     atggcgacaa aaggcagggt tgaagggaag gtcgttctta tcaccggtgc ggcgcacggg        60
     ctgggcaagg ccgatgccga ggcgctggcg cgcgagggcg cgcgggtgat cgtcgccgac       120
     gtcgacgagg aggaagcgca gcgggtcgtc gacatgcttc cggcagcgat ggcgctccgc       180
     ctggacgtga cctgcgaagc gcaatggcag gccgcgttga cgaaaatcat gcaggcctat       240
     ggccggctcg atgggctggt caacaatgcg ggcattgccg cctttgaaac ggtcgagcag       300
     tcgtcgctgg aggcattccg ccgcgtgatg gccgtttcgg cggaagggac gttcctggga       360
     tgcaagacct gcctgccggc gctggcggcc agcggcgcgg gatcgatcgt caacatcgcg       420
     tcggtggccg cgatccgggg caatccggcc gtgttcgcct atagcgcggc gaagggcgcc       480
     gtgctctcca tgacgcgcag cctgatcgtg cattgccagc agcagggcta tcccgttcgc       540
     gccaatgtgg ttctccccgg ctcgcacgat acgcagatgg tgcgcgaagc ctatcgcttc       600
     gccgcgcccg aattgcgcga agccgcccgc aagcacgaag gacagccgga gcatgtcgcc       660
     gacctggtcc tgttcctggt gtcggatgag tcggcccggt tgaacggcgc ggagatcgtc       720
     atcgacaatg gccggacggt ggggtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page