(data stored in ACNUC7421 zone)

EMBL: AP010803.PE398

AP010803.PE398       Location/Qualifiers
FT   CDS_pept        complement(409952..410374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03980"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /note="Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95232"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY00"
FT                   /protein_id="BAI95232.1"
FT                   /translation="MPDTLPVPIADDLICPDADGIALLASRERATHRLCFPARPEDDTR
FT                   YDRVLLPRTGRLWSWTVQRFRPKSPPYAGPEAFEPYAVGYVELDGALIVEGRLVDVAFD
FT                   DLAIGMAMRVVPLPFPLADGTVRTSFGFAPDGSAGI"
     atgcccgaca ccctgcccgt tccgatagcc gacgacctca tctgccccga tgcggacggc        60
     attgcgctgc ttgcctccag agagcgggca acccatcgcc tgtgctttcc ggcgcggccg       120
     gaagacgaca cgcgctatga ccgcgtcctg ctgccgcgca cgggccggct ctggtcgtgg       180
     actgtccagc gcttccgccc caagtcgccg ccctatgccg gcccggaagc gttcgagcct       240
     tacgctgtgg gctatgtcga actggatggg gcgctgatcg tcgaaggccg cctggtcgac       300
     gtagcgttcg atgatctggc aatcggcatg gcgatgcgcg tcgtgccgct gcccttcccg       360
     ctggcggacg gcacagtgcg caccagcttc ggcttcgcac cggacgggag cgccgggata       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page