(data stored in ACNUC7421 zone)

EMBL: AP010803.PE401

AP010803.PE401       Location/Qualifiers
FT   CDS_pept        411977..412729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04010"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95235"
FT                   /db_xref="GOA:D4YY03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY03"
FT                   /protein_id="BAI95235.1"
FT                   /translation="MQVEGKTALVTGASSGLGRHFARLLAREGATVVAAARRVDALSAL
FT                   SDEIGRQGGTCIPVAMDVTDPDAVAAAFGQIERDLAAPLSILVNNAGVAHTRAALDLSA
FT                   SEWSQVLQPNLTGAFLVAQQAARMMRGQGGTIVNVASILGERVSKGLAAYAASKAGLIQ
FT                   LTKALALEWAAFDIRVNALAPGYIETDLNRDFFASDAGQRLISRIPQKRLGQMQDLDGP
FT                   LLLLCSDQSRYMTGAVIAVDGGHLVSGL"
     atgcaagttg agggcaagac agcgctggtc acgggggcga gttcgggttt gggccggcat        60
     ttcgctcgcc tgctggcgcg ggaaggggcg acggtcgtgg cggcggcgcg ccgagtcgac       120
     gcgctttcgg cgctctccga tgagatcggg cggcagggcg gcacatgcat tcccgtcgcc       180
     atggatgtga ccgatccgga cgcggtggcg gcagccttcg ggcaaatcga gcgcgacctt       240
     gcagcgccgc tctccatcct cgtcaacaat gcaggcgtag cccacacgcg cgcggcgctc       300
     gatctcagcg cgtccgagtg gtcgcaggtg ctccagccca atctgaccgg cgccttcctc       360
     gtggcccagc aggcggcgcg catgatgcgg ggccaagggg gaacgatcgt caacgtcgcc       420
     tcgatcctgg gggaacgcgt gtccaagggg ttggccgcct atgccgccag caaggccggc       480
     ctcatccaat tgacgaaggc gctcgcgctg gaatgggcgg cgttcgacat aagggtcaac       540
     gcgctggcgc ccggctatat cgagacggac cttaaccgtg acttcttcgc gtccgacgca       600
     ggtcagcggc tcatctcgcg catcccgcag aagcgactcg gccagatgca ggatctggac       660
     gggccgctcc tgctgctatg ttccgatcag tcgcgctaca tgacgggcgc ggtcatcgcg       720
     gtggatggcg ggcacctcgt cagcggtctt tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page