(data stored in ACNUC7421 zone)

EMBL: AP010803.PE402

AP010803.PE402       Location/Qualifiers
FT   CDS_pept        complement(412839..414272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04020"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria / DNA
FT                   recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95236"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY04"
FT                   /protein_id="BAI95236.1"
FT                   /translation="MDSLAAILVIVALVAGLGIGWLAKGRSMAPLLAEKADLAGKLDMA
FT                   ATQRNAAIQELVVAQERAAQAADLARKLEAERAGREAAARELAALRSDAQARAEAFEAQ
FT                   IAALKDAKEQLSAQFSEIGGKLLHQAQSHFLERADQRMMQAHEKSEAQLRQLLHPVNET
FT                   IQRYDQKITQIEQQRTEAYGILRGEIESMKTGQEAVRAEAQRLVDSLRHAPKARGRWGE
FT                   QQLRNVLETCGLSEHVDFQTEVSVEGEDGRLRPDAILRVPGGRALVIDAKVSLNAYQDA
FT                   YGAEGDEERKRLLSAHAAAMRAHVETLGRKSYAEQFDDAPDYVIMFVPGEHFLSAALEH
FT                   DPQLWDHAFAKRVLLATPTNLIAIARTVAAVWRQEKMADEAKRIGMLGKELYERLAGAA
FT                   GSLKKLGNRLNGAVADYNSFVGSFEGRVLVTGRKLRDLNIETGGKELEELEPVEALVRE
FT                   PSSAEAVRALPDALPDAAE"
     atggacagcc tggccgccat tctcgtcatt gtcgccctgg tcgcggggtt ggggatcggc        60
     tggctggcga agggccggtc catggcgccg ctgctggcgg aaaaggccga tctggcgggc       120
     aagctcgaca tggcggcgac gcagcgcaac gcggcgatcc aggaactggt ggtggcgcag       180
     gagcgcgcgg cgcaggcggc ggacctggcg cggaagctgg aggcggagcg cgccgggcgg       240
     gaagcggcgg cgcgggaact ggcggctttg cggtccgacg cgcaggcgcg ggcggaagcc       300
     ttcgaagcgc agatcgccgc gctcaaggac gccaaggagc agctttcggc ccagttcagc       360
     gagatcggcg gcaagctgct gcaccaggcg cagagccatt tcctggaacg cgccgaccag       420
     cgcatgatgc aggcgcatga gaaaagcgag gcgcagctca ggcaattgct gcatcccgtc       480
     aacgagacga tccagcgtta cgaccagaag atcacccaga tagagcagca gcggacggag       540
     gcctacggca tcctgcgcgg cgagatcgaa tcgatgaaga ccgggcagga agccgtgcgc       600
     gccgaggcgc agcggctggt cgattcgctg cgccatgcgc ccaaggcgcg cggccgctgg       660
     ggcgagcagc agttgcgaaa cgtgctggag acatgcggcc tttccgaaca tgtggatttc       720
     cagaccgagg tgagcgtgga gggcgaggac ggccggctgc gccccgacgc gatcctgcgc       780
     gtgccgggcg ggcgggcgct ggtgattgac gccaaggtgt cgttgaatgc ctatcaggac       840
     gcctatggcg cggaggggga cgaggagcgg aagcggctgc tgtccgccca cgccgccgcc       900
     atgcgggcgc atgtcgagac gctggggcgg aaaagctatg ccgaacagtt cgacgatgcg       960
     cccgattatg tgatcatgtt cgtgcccggc gaacatttcc tgtccgccgc gctggagcat      1020
     gatccgcagc tttgggacca tgccttcgca aagcgggtgc tgctggcgac gccgacaaat      1080
     ctgatcgcca tcgccaggac cgtcgcggcg gtgtggcggc aggagaagat ggcggacgag      1140
     gccaagcgaa tcggcatgct gggcaaggaa ctgtacgaac gactggcggg ggcggcgggg      1200
     tcgctcaaga agctgggcaa tcggctgaac ggggccgtgg cggattacaa cagtttcgtc      1260
     ggcagcttcg agggccgcgt tttggtgacg ggccgcaagc tgcgcgacct caacatcgag      1320
     acgggcggca aggaactgga ggagttggag ccggtggagg cgctggtccg cgaaccgtct      1380
     tcggctgagg cggtgcgggc tttgccggat gcgctgccgg atgcggcgga atag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page