(data stored in ACNUC7421 zone)

EMBL: AP010803.PE404

AP010803.PE404       Location/Qualifiers
FT   CDS_pept        415649..415837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95238"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY06"
FT                   /protein_id="BAI95238.1"
FT                   /translation="MIDRLFLKHPRDVHESYGEHFEVATRFGFLMVRAGLACMVHGLVP
FT                   AFFTRTGSATVKRLYAE"
     atgatcgacc gcctgttcct gaaacatccc agagacgtcc atgaaagcta tggcgagcat        60
     ttcgaggtgg cgacgcgctt cggcttcctg atggtgcgcg cggggctggc ctgcatggtc       120
     cacgggttgg tcccggcttt cttcacccgc accggcagcg cgacggtgaa gcggctgtac       180
     gccgagtaa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page