(data stored in ACNUC7421 zone)

EMBL: AP010803.PE405

AP010803.PE405       Location/Qualifiers
FT   CDS_pept        complement(416221..416976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95239"
FT                   /db_xref="GOA:D4YY07"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY07"
FT                   /protein_id="BAI95239.1"
FT                   /translation="MVQLLTATLEQRRSCFTKLIVAIVRQAMTYRRGKGNPLSREEIDR
FT                   LNSLLPGVQFKIPELLDPSFLSSFGSPKAAERAPQASSTLGAEKEQELAALLIEITKLD
FT                   PQARGLRFEGFLNELFAGFGLAPRGSFRLVGEQIDGSFKLHGQTYLVEAKWHGPQIGFA
FT                   DLMTFSGKVGGKASWSRGLFVSNSGFTAEGLEAFSRGRQTNLICADGLDLYEVLSRKVS
FT                   LITVLEAKERRAAETNRAFVAVRDLNLGG"
     atggttcaac tcctgaccgc gacgctggaa cagcgcaggt cgtgctttac gaaattgatc        60
     gtggcgatcg ttcgccaagc gatgacctac cggcggggga agggaaatcc gctcagtcgt       120
     gaagagattg atcgactcaa cagccttctt cccggggtgc aattcaagat ccctgagctg       180
     ctcgatccga gcttcctaag cagcttcggc tcgccaaagg ccgcagagcg agcgccgcag       240
     gcgtcgtcga cgctgggcgc ggagaaggag caggagctcg ctgcgctcct catcgagatc       300
     accaagctcg atccccaggc gcgtggtctg cgtttcgagg gctttctgaa cgagctgttc       360
     gccgggttcg ggctggcgcc gcgcggctct tttcggctcg tcggcgagca gatcgacggg       420
     agcttcaagc tgcacggtca gacctacctg gttgaagcaa aatggcatgg gcctcagatc       480
     ggctttgccg acctgatgac cttttcgggc aaggtcggtg gaaaggcatc ttggtcgcgc       540
     gggctgttcg tcagcaattc cggcttcacg gccgaggggc tggaggcgtt ctcgcgcgga       600
     cgccagacca acctcatatg cgctgacggg ctcgacctct atgaggtgct ctcgcgcaag       660
     gtttcactca tcaccgtttt ggaagccaag gagcggcgtg cggccgagac gaaccgggcg       720
     ttcgtcgctg tgcgggacct gaatcttggg ggatga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page