(data stored in ACNUC7421 zone)

EMBL: AP010803.PE408

AP010803.PE408       Location/Qualifiers
FT   CDS_pept        complement(420760..423312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04080"
FT                   /product="putative subtilisin proteinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95242"
FT                   /db_xref="GOA:D4YY10"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY10"
FT                   /protein_id="BAI95242.1"
FT                   /translation="MAEPDNFDARDRPHIAIDVFRETAAYTFPSRNQERKPLRGDYAAH
FT                   ATQLLDQLAAALGTVPVAAADPRLPVQGLKSGTVVEVTTLPPAEGSRTKAVKVPATLEF
FT                   PTQDVVILRSERNEDRTESALLFVPDDARAFLRNRITDYGRDPGNQRRPDVERFEVIEE
FT                   VRAVEVGSLFTGVVDLAAPDILWWELWVRQPVALADRLAAAARNANIDVHDDRLIFPDT
FT                   TVVFLHAAAAAVAAFAARVPGAITEIRRATGTIEPFLDRGDTGFGQHDWVDELAQRVSP
FT                   PSPDAPVVCTLDTGVTAAHPLIAPGLRGAWAYDADWGADDHEPYGGHGTPLAGLVLYGD
FT                   LEPLMNDARPVDLTHGAESMKLLPPGGFPPTKPPSYGVVTQGAVSLVEIERPEAVRSFC
FT                   IATSATDFPPSRPSTWSGAIDQISAGAMPGEADDAVPAAERSKRLIVVATGNVSGGMAV
FT                   DVLPSQPLEDPSQSWNALTIGGFTRKEQPPAPPPVLQAAVPANHRSPFSRGSQSLPDDL
FT                   TPIKPEVLFEAGNMMSDATGFCGWDPAVSLLSAGSDVATEPLVPFWATSAAAGMAGNFI
FT                   GRLQAARPDLWAETHRALTVDSARWPEPIRKRFIGTGAHWKTGKAATKGKKQEMLREFG
FT                   YGVPDIDRAILSARNDATLVAQAEIQPFAIGADGRTGVFNEMHFYDLPWPKAALEKLEN
FT                   EIVTMKVTLSYFIEPNLAGKAATRPDTYRSFGLRFDMKKRTETAARFRSRISASQAKDG
FT                   TEADGEASCWLLGPKAIQAGSLHCDLWRGRAIELAGHDAIAVYPVGGWWKSHVGQKRVA
FT                   DKARYALVISISAPGQDVDLYSEINTLVENKEIEVLLG"
     atggcggagc ccgataattt cgacgcgaga gaccgtccgc atatcgcgat cgacgtcttt        60
     cgtgaaacag cagcctacac ttttccctcg cgcaatcagg aacgcaaacc ccttcgggga       120
     gactatgcgg cgcacgccac gcagctcctc gaccagctcg ctgcggcgct ggggaccgtt       180
     ccagttgcgg ctgccgatcc gcgcctgccc gtgcaggggc tgaaatccgg cactgtcgtg       240
     gaggtcacga cgttgccgcc ggcggaaggc tcgcggacca aggccgtcaa ggtgccggcg       300
     accctggagt ttccaacgca ggacgttgtg atcctgcgat cggagcgtaa cgaggaccgc       360
     accgaaagcg ccttgctgtt cgtgcccgac gacgcacgcg ccttcctgcg gaatcgcatc       420
     actgactatg gtcgcgatcc cggtaatcag cgacgtcccg atgtcgagcg gttcgaggtc       480
     atcgaagaag tcagggcggt ggaagtcgga tcactgttca ccggcgtggt ggatctggct       540
     gcgccggaca tcctctggtg ggagttgtgg gttcgccagc cggtcgcgct ggcggaccgc       600
     ctggccgctg cggctcgcaa cgcgaacatc gatgtgcatg acgatcgcct gatcttcccg       660
     gatacgacgg tcgtcttcct tcacgcagcc gccgcggcag tggccgcgtt cgcggcgcgc       720
     gtgccaggcg ccatcaccga gatacgccgg gcaacaggaa cgatcgagcc atttctcgat       780
     cgtggcgaca ccggctttgg acagcatgat tgggtggacg agctggcgca gcgcgtcagc       840
     ccgccgtctc cggacgctcc agtggtctgc acgctcgaca cgggtgtcac ggcggcccat       900
     ccgttgattg cgcccggctt gcgtggggct tgggcttacg atgctgattg gggcgcggac       960
     gatcacgagc cgtacggcgg tcacggcaca ccacttgcgg gactcgtcct ttacggcgac      1020
     ctcgaaccat tgatgaacga cgcgcgcccc gtcgatctga cgcatggcgc cgaatccatg      1080
     aagctgctgc cgcctggtgg atttccaccg accaaaccgc ccagctatgg agtggtgacg      1140
     caaggcgctg tcagcttagt ggagatcgag cgcccggaag cggtgcggag cttctgcatt      1200
     gcaacgtctg ccaccgattt cccacccagc cggccttcga cttggagcgg agcgatcgac      1260
     cagatctcgg ccggtgccat gcccggtgag gctgacgacg ccgtgccggc cgcggagcga      1320
     tccaagaggc tgatcgtcgt tgcgactgga aacgtctccg gcggcatggc ggtagacgtc      1380
     ctgccctcgc agcctctgga agacccatca cagagctgga acgcccttac catcggcggc      1440
     ttcacgcgga aggagcagcc gccagcgccg ccgcccgtgt tgcaggccgc cgtcccggcc      1500
     aatcaccgca gtccgtttag tcgtggctcg cagtcgctgc ctgacgacct gacgccgatc      1560
     aagccggagg tgttgtttga ggccggcaac atgatgtcgg acgcgaccgg cttttgcggc      1620
     tgggacccgg ccgtttctct tctctcggcc ggctccgatg tcgcgaccga accgctcgtg      1680
     ccgttctggg caacgagcgc ggccgctgga atggccggaa acttcatcgg ccgcctgcaa      1740
     gcggctcggc cggacctatg ggcagaaacg catcgcgcgc taaccgtgga ttcggcccgt      1800
     tggcccgaac cgatccggaa aaggtttatc ggcaccggag cccactggaa gaccgggaaa      1860
     gcggccacca agggcaagaa gcaggagatg ctccgcgagt tcggatatgg cgtgccggac      1920
     attgatcgag ccatcctctc ggcgcgcaac gatgccacgc tggtcgcgca ggcggagatc      1980
     cagcccttcg cgatcggtgc ggacggccgg accggcgtgt tcaatgagat gcatttctac      2040
     gatctgcctt ggccgaaagc agcgttggag aaactcgaaa acgagattgt cacgatgaag      2100
     gtgaccctgt cgtacttcat cgagcctaac ctggccggca aggcggctac ccgacccgac      2160
     acatatcgct ccttcgggct gcggtttgac atgaagaagc gcacggagac ggcggcccgg      2220
     tttcgcagcc gtatttccgc gagccaggcc aaggacggca ccgaagccga tggcgaggcc      2280
     agttgctggc tcttggggcc gaaagccatc caggcggggt cgctgcattg cgacctgtgg      2340
     cgcggcaggg cgatcgaact ggcgggtcac gacgccatcg cggtctatcc ggtcggcgga      2400
     tggtggaagt cgcacgtcgg ccaaaagcgt gtggctgaca aagcgcggta cgctctagtc      2460
     atttcaatct ctgcgcccgg tcaggatgtc gatctctaca gtgagatcaa tacgcttgtt      2520
     gagaacaagg agatcgaggt gctactcggc tag                                   2553
//

If you have problems or comments...

PBIL Back to PBIL home page