(data stored in ACNUC7421 zone)

EMBL: AP010803.PE41

AP010803.PE41        Location/Qualifiers
FT   CDS_pept        complement(42101..42595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00410"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative secreted (periplasmic) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94875"
FT                   /db_xref="GOA:D4YWZ3"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ3"
FT                   /protein_id="BAI94875.1"
FT                   /translation="MKLWPLLFVTLSLSACGLRPVYSGGSHGAVAQALGNVAVQPIEGK
FT                   GGWLVRNALNDRLAAMSGTGPGYRLVVKLDDNISGFGLRSDAAITRERRTLRARYQLID
FT                   EATGAQILDDTAGSDVGIDVVSSEYATIAAEDTALERLSQTIADQIVARLARFAARDKG
FT                   R"
     atgaagctct ggccattgct ctttgtcacc ctgtccctct ccgcctgcgg cctgcgcccc        60
     gtatatagcg ggggcagcca cggcgcagtc gcgcaggcgc tgggcaatgt cgcggtgcag       120
     ccgatagagg gcaagggcgg ctggctggtg cgcaacgcgc tgaacgaccg gctggcggcg       180
     atgagcggca ccggccccgg ctaccggctg gtggtgaagc tggacgacaa tatcagcggc       240
     ttcggcctgc gctccgacgc cgccatcacc cgcgagcggc ggaccctgcg cgcccgctac       300
     cagttgatcg acgaagccac cggcgcgcag atattggacg acaccgccgg atcggacgtc       360
     ggcatcgacg tggtgtccag cgaatatgcg accatcgcgg cggaggatac ggcgctggaa       420
     cgcctgtcgc agaccatcgc cgaccagatc gtcgcccggc tcgcccggtt cgcggcgcgg       480
     gacaagggcc gttga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page