(data stored in ACNUC7421 zone)

EMBL: AP010803.PE410

AP010803.PE410       Location/Qualifiers
FT   CDS_pept        complement(424365..424697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95244"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY12"
FT                   /protein_id="BAI95244.1"
FT                   /translation="MTSGNGFSIMFSICSNLWSRESRPVAMSSTESPPRWKCPSMVRPV
FT                   GQPLIRVGFTPHGAKEWLGSSVVERKRWRFWTDSDSVRGASDSHKHLSKQQYSEARPKK
FT                   GGEYVD"
     ttgacctccg ggaatgggtt cagcatcatg ttctccattt gttctaatct ttggtcgaga        60
     gagtcaaggc ccgtcgccat gtcgagcacc gaatctcccc cgcgctggaa atgcccgtcg       120
     atggtccggc cggttgggca gccgctgatc agggtgggct ttacgcccca tggggcgaaa       180
     gaatggttag gaagctctgt ggtagagagg aaaaggtggc gcttttggac ggattccgat       240
     agcgtgcgcg gagcgagcga cagccacaag catctgagca agcaacagta tagcgaggcc       300
     agaccaaaga aaggaggcga gtatgtcgac taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page