(data stored in ACNUC7421 zone)

EMBL: AP010803.PE411

AP010803.PE411       Location/Qualifiers
FT   CDS_pept        424733..425458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04110"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95245"
FT                   /db_xref="InterPro:IPR017026"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY13"
FT                   /protein_id="BAI95245.1"
FT                   /translation="MRAQIEKIEGRGRRAKSVLPFGIAAMDSRLPGEGLALGALHEVAG
FT                   GGNGAIDGAAAALFSAGVAARTKGKVLWCITRPDLFAPAIAQAGLAADRVIYVEAGDDK
FT                   TVLACMEEGLRHGGLGAVVGEVARLSMTASRRLQLAAEGGGAIAIALRRWRRQTEAADF
FT                   GQPTAAMTRWRISVLPSTPLPVPGVGRPRSLVELIRARAGESADFELEACDDTGRLALP
FT                   AELVHRPAAAEGWRRGASG"
     ttgcgcgcgc agatcgaaaa gatcgaaggc cgcggccggc gcgccaaatc ggttctcccc        60
     ttcgggattg ccgcgatgga ctcgcgtctg ccaggcgaag ggctcgccct cggcgcgctg       120
     catgaagtag ccggcggcgg caatggcgca atcgacggag ccgccgctgc gcttttcagt       180
     gcgggggtcg ccgcccgcac caagggtaag gttctgtggt gtatcaccag gcccgatctg       240
     ttcgctccag cgatcgcgca ggccgggctg gcggccgacc gcgtgatcta tgtcgaagcg       300
     ggcgacgaca agaccgtgct cgcctgcatg gaggaagggt tgcgacatgg cggcctcggc       360
     gctgtcgtcg gagaggtcgc tcgtctctcc atgaccgcct cccgccgcct gcaactcgcc       420
     gctgaaggtg gcggcgccat cgccattgca ttgcgacgat ggcgacgtca gacggaggcg       480
     gccgatttcg ggcaaccgac cgcagccatg actcgctggc ggatctccgt tctgccgtcg       540
     acgccgctgc ccgtcccggg cgtcgggcgc cctcgatcgc ttgtcgagct gatccgcgct       600
     cgcgcgggcg aaagtgcaga tttcgaattg gaggcgtgcg atgacacggg tcgtctcgct       660
     cttcctgccg agctggtcca ccgaccggct gcggcggaag gctggcgacg cggcgcatcc       720
     ggctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page