(data stored in ACNUC7421 zone)

EMBL: AP010803.PE414

AP010803.PE414       Location/Qualifiers
FT   CDS_pept        complement(430203..430793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04140"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95248"
FT                   /db_xref="GOA:D4YY16"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY16"
FT                   /protein_id="BAI95248.1"
FT                   /translation="MCNDYRLTVDVASIVEDFADLKIKIRFGEGAPNIAARDDIKITDV
FT                   GAIVRTIEGVRGEGDLVQRRWSWPGQNKRPVYNFRSEGRAFGSNRCLIVADGFYEFTDA
FT                   AEKGKKRKDKWLFTKRDEPIFCIGGIWRETKEVGEAFTMLTMEPGPDIAPYHDRQIVIL
FT                   ERDAWTGWLNPSVPAQSLIRPLPAGSLLVEQVG"
     atgtgcaatg attaccgtct gacggtggac gtcgcctcga tcgtagagga cttcgccgat        60
     ctgaagatca agatccgctt cggcgaaggc gcgccgaaca tcgcggcgcg cgacgacatc       120
     aagatcaccg atgtcggggc gatcgtccgc accatcgagg gcgtgcgcgg cgaaggcgac       180
     ctcgtgcaac ggcgatggag ctggcccggg cagaacaagc gcccggtgta taattttcgg       240
     tcggaggggc gcgctttcgg gtcgaaccgc tgcctcatcg tggccgatgg tttctacgag       300
     ttcaccgacg cggccgagaa gggtaagaag cggaaggaca agtggctctt caccaagcgc       360
     gacgagccga tcttctgcat tgggggcatc tggcgcgaga cgaaggaggt tggtgaggcc       420
     ttcaccatgc tgacgatgga gcccgggccc gacatcgcgc cctatcacga ccggcagatc       480
     gtcatcctcg agcgcgatgc ctggaccggc tggctgaacc cttccgtgcc ggcgcagtcg       540
     ctcatccgcc cgctgccggc ggggtcgttg ttggtcgaac aggtcggctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page