(data stored in ACNUC7421 zone)

EMBL: AP010803.PE416

AP010803.PE416       Location/Qualifiers
FT   CDS_pept        complement(431418..433307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04160"
FT                   /product="putative signal transduction protein"
FT                   /note="putative signal transduction protein containing a
FT                   membrane domain, an EAL and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95250"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY18"
FT                   /protein_id="BAI95250.1"
FT                   /translation="MPLLQVENRILRLIANGVSLEETARQLCLEIEALLPDVVCTLMTV
FT                   DPAGLLHPLATPSLPDAYALAIDGVMIGPEVGSCGTAAYMRKTVGIADIAADPRWARYK
FT                   DHALVAGLKACWSYPIISESGDPIGVLALYFREHRGPREAEMGVISTALDLCGMALRRH
FT                   ERVVDRERRANVDVLTGLPNRAAFNAALECMPCDEPGIWALFMIDLDNLKIVNDTFGHL
FT                   AGDRLIQVAAARIARAVAPDVTFRIGGDEFAVLVQAPALLSDLDAAARRIFRGLELAAP
FT                   CEGHMVVPQATIGGAVFGPSESTAAAVSEAADFALYHAKETGRGGFVRYWPGIGTRITH
FT                   RRDAIRDVAAALGDGRIEAHYQPIVGLDTGEIVGLEALCRMRGRDGTLIAAHEFHEATA
FT                   DAHIAAELTEHMAAMIAGDMVRWRDQGLRVGHVGLNVSSADFYTGSISKKLERAFGPVG
FT                   VPLDQLVVEVSEDVYIGRRDGVVAREIERLRATGVRVALDDFGTGHASLTHVLNVPVDI
FT                   IKIDRSFVERLWPDDPSIVIVEGLIKIARRLEIMVIAEGIETEVQASQLWSMGCMLGQG
FT                   FAFARATDRDATAALLRRHAAGIAGVTPLYAGRKGMLREPDAAAPARRRTAAG"
     ttgccattgc tgcaggttga aaaccgaata ttgcgtctga tcgccaatgg cgtctcgctc        60
     gaggagacgg cccgtcagct atgcctggag atcgaggcgc ttctgccgga cgtggtctgt       120
     acgctgatga cggtggaccc cgccgggctg cttcatccgc tggcgacacc gagtttgccc       180
     gacgcctatg cgcttgcgat cgatggcgtg atgatcgggc cggaggttgg gtcctgcggc       240
     acggccgcct atatgcgcaa gacggtcggc atcgccgata tcgccgcgga tccccgatgg       300
     gccagataca aggatcacgc gctcgtcgcc ggcctgaagg cctgttggtc ctacccgatc       360
     atctccgaga gcggcgatcc gatcggcgtg ctcgcccttt atttccgcga gcaccgcggt       420
     ccgcgcgagg cggagatggg ggtcatcagc acggccctgg atctctgcgg catggcgcta       480
     cggcgccatg aacgtgtggt cgaccgggag cgacgggcga atgtcgatgt tctgaccggt       540
     cttcccaacc gggcggcgtt caacgctgcg ctggagtgca tgccctgcga cgagcccggc       600
     atctgggccc tgttcatgat cgatctggac aatctgaaga tcgtgaacga caccttcggg       660
     caccttgcag gcgacaggct gattcaggtc gctgcggctc gcattgcccg cgccgtcgcg       720
     ccggacgtga cgttccggat cggcggcgac gagttcgccg ttctggtcca ggcgcccgcc       780
     ttgctgtcgg acctcgacgc ggcggcgcgt cggatcttcc gcgggctcga gctcgccgcg       840
     ccttgcgagg gccatatggt ggtgccccag gcgacgattg gcggcgcagt gttcggtccc       900
     tcggagtcga cggccgcggc ggtgagcgag gcggcggact tcgcgctcta tcatgccaag       960
     gagactggca ggggcggatt tgtgcggtac tggcccggca tcgggacgcg gatcacgcac      1020
     cgccgcgatg cgatccgcga tgtggccgcg gcgcttggtg acggtcgtat cgaggcccac      1080
     taccagccga tcgtcgggct ggacacgggg gagattgtcg gcctcgaagc cctgtgccgc      1140
     atgcgagggc gggacgggac gctgattgcg gcgcacgaat ttcatgaggc aacggcggac      1200
     gctcacatcg cggccgagct gaccgagcat atggccgcga tgatcgccgg cgacatggtc      1260
     cggtggcggg accagggcct gcgggtcggg cacgtcggct tgaacgtctc ctcggcggac      1320
     ttctacaccg gaagcatttc gaagaagctc gaacgtgcgt tcggccctgt tggcgtcccg      1380
     ctcgaccagc tcgtggtgga ggtgagcgag gacgtctata tcggccggcg tgacggcgtc      1440
     gtggcgcgcg agatcgagcg tctgcgcgcc acgggcgtcc gggtcgccct cgatgacttc      1500
     gggacgggac acgcgtcgct gacgcatgtg ctgaatgttc cggtcgatat catcaagatc      1560
     gaccgcagct tcgtcgagcg gctctggccg gacgatccga gcatcgtcat cgtcgagggg      1620
     ctgatcaaaa tcgcccgccg gttggagatc atggtgatcg ccgaggggat cgagaccgag      1680
     gtgcaggcga gccagctttg gtcgatgggc tgcatgctcg gccagggatt tgcgttcgcc      1740
     cgggcgacag accgcgacgc gaccgccgca ttgctgcgcc ggcacgccgc cgggattgcg      1800
     ggcgtcactc cgctttacgc cggccggaag ggcatgcttc gcgagccgga cgcggcggcg      1860
     cccgcccggc gtcggacagc cgcgggctga                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page