(data stored in ACNUC7421 zone)

EMBL: AP010803.PE419

AP010803.PE419       Location/Qualifiers
FT   CDS_pept        435904..437691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95253"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY21"
FT                   /protein_id="BAI95253.1"
FT                   /translation="MTAAPRKGRKVSFAADTAAPQADPWSQISTLRFMIHPLYGGELLV
FT                   DFTGLRPRGLALAFARSLFMLAAPRGPIMVRSSLKTYANQLPSFFSYLAGTGDGINGPA
FT                   DLRAHHIDGFETWLSAQGKSCVHGPTYVAKVVSVLRRIADDSPELVDCGLRERLRYVSS
FT                   HAHVRSRPRDAYSPYVARQLRDAARADIAAIEARLRSGPQFDEVPQIDGAYCKAHAAIE
FT                   TYGVLGYRDPTFQSLYKLRKKRDLTSDRLNLSLHAAHYLTADDIVPLLVLLLIETGLEL
FT                   ECCKSLTLDCLRNAAGGTVDIAYTKLRAHGAEHKTIRVRDRGSSTAGGLIRRIIALSSK
FT                   ARVHNSSDNLWVYFQPGEITAGIRQLRLKVSAWTQRHCITDDQGKPLHLCLSYLRKTHK
FT                   ALWYLKTEGHMARFAVGHTVDIAARHYADIPSLRPLHEQTVADALEEVLAGPMILPPQD
FT                   EDRLRGELASPDPDDGGISTALLNGEQDVWLASCGNFYSSPFASAGTPCPTPFWACLDC
FT                   RNAVITARKLPAILTFLSFVDAQRIGLSAADWTAKFGHAHDRIVQQILPAFAEDVVTRA
FT                   RAQVANDPPTVYLPPEARA"
     atgaccgctg ctccacgcaa aggacgcaag gtcagcttcg cggcagatac ggctgcgccc        60
     caagccgatc catggtcgca gatcagcacg ctgcgcttca tgattcatcc cttatatggc       120
     ggcgagctgc tcgtcgattt cacgggcttg cggccacgcg gcctggcgct cgcatttgcc       180
     cggagcctgt tcatgctggc tgctccgcgc ggccccatca tggtacgttc gtcgctcaag       240
     acatacgcca accagctgcc aagcttcttt tcctacctgg ccgggacagg cgacgggatc       300
     aacggccctg ctgaccttcg tgcccatcac attgatggat ttgagacatg gctcagcgcg       360
     cagggcaagt cttgcgtgca tggaccaacc tatgtcgcca aggtcgtttc cgtccttcgt       420
     cgcatcgcgg acgacagccc cgagcttgtc gattgcggct tgcgggaacg actgcgctac       480
     gtcagctcac acgcacacgt tcgttcccgt ccacgcgatg cctacagtcc gtatgtagcc       540
     cgccagctgc gcgatgcggc acgcgcggat atcgctgcga tcgaggcgcg cttgcggtcg       600
     gggccgcagt tcgatgaggt gccgcagatc gatggcgcat attgcaaagc ccatgctgcc       660
     atcgagacat acggtgttct gggctaccgt gatcccacgt ttcagagcct gtacaagctg       720
     cgcaaaaagc gcgatctcac cagtgacagg cttaacctga gcctccacgc agcccactat       780
     cttactgccg acgatatcgt cccgcttctt gttctgctct taatcgagac agggcttgag       840
     ctggagtgct gcaagtcgct caccctcgat tgtctgcgca atgccgcagg gggtaccgtc       900
     gatatcgcct acaccaagct gcgggcacac ggtgccgagc acaagacaat ccgggtgcgt       960
     gatcgcggct catccaccgc tggcggtctg atccgacgca tcatcgccct atcgtccaag      1020
     gccagggtcc ataactccag cgataacctt tgggtctatt ttcagccggg cgagatcacc      1080
     gcaggtattc gtcaactgcg cttgaaggtc agtgcctgga cgcagcgcca ttgtattacc      1140
     gatgatcagg gtaaaccgct ccacctgtgt ctttcgtatc tgcgcaagac gcacaaggcc      1200
     ttgtggtatc tcaagaccga aggccacatg gcccgcttcg ccgtaggtca taccgtcgat      1260
     atcgcggcac ggcactacgc cgatattccc tccctcagac cgctgcacga gcaaaccgtg      1320
     gcagatgccc tcgaagaggt gctcgctggt ccaatgatcc tgcctcctca agacgaggac      1380
     cggctgcgcg gcgagttggc aagccctgat cccgatgatg ggggcatttc aaccgcactg      1440
     ctcaatggcg aacaagacgt ctggcttgca agctgtggca acttctattc cagtcccttc      1500
     gcatccgccg gcacgccatg ccctacaccg ttctgggcct gcctcgattg ccgcaacgcg      1560
     gtcattaccg cgcgcaagct gcctgccatt ctcacctttc tctccttcgt cgacgctcag      1620
     cggatcggcc tgagtgctgc tgattggacc gccaagtttg gtcatgccca tgatcgcatc      1680
     gttcagcaga ttctgcctgc cttcgccgaa gacgtcgtga caagggcccg tgcgcaagtc      1740
     gcgaacgacc ctcccacggt ctatctgccg ccagaggcac gggcatga                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page