(data stored in ACNUC7421 zone)

EMBL: AP010803.PE420

AP010803.PE420       Location/Qualifiers
FT   CDS_pept        437688..439913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95254"
FT                   /db_xref="GOA:D4YY22"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY22"
FT                   /protein_id="BAI95254.1"
FT                   /translation="MTVVQLLAESDDERDALPVLMSAPLRPGCDRAHISRYGDPVWDLA
FT                   PGVFRDNARRCHVTVHFGGIKDPSIADALRQILHARLNVDLPGHRSRLEPAGVRGEANR
FT                   TLRFFDFVKAQLGRFDLARVDQALVDRYAGALRLAGLRPVAAAALLRIVFDLHELQHHL
FT                   PTARLSFEPWPGRSPFSVAGAKHIAGENRTPRIPEAIMTPLLSWSLRYVTCYAGDILAA
FT                   RAELDCLEATRNRLIAAEEGLDPAVRRLRQRQRLLDYVASLRQHGRGIPIWTTAHNGAT
FT                   RTDPQTGAVTPPINYHLIHLHAGINAQAEPAMHLGLATGAPDLIAAAIAELGTEIGGMD
FT                   TPNSADPDTGMPWRTRFDAKVLPLEEVMLQSAAYIVCAFLSGMRDSEIQAMRRGCLSIT
FT                   KAEDGTILRHRIKSTAYKGKRGGGEETEWVTIAPVAEAIDVLERLSARAGQARGTTTLW
FT                   PVLTLRANTKTHVSAEIVRQLNRFRDHLNDHFGSAQAPVIPAGPDGRPWRLTTRQFRRT
FT                   IAWHIANRPFGTIAGMIQYKHASVAAFEGYAGSSRSGFRGEIEAQRALGQIDDILVYFD
FT                   ERQSGARLGGPAANRVGVVLDTAAHELAPLPAMIADRPRLRTMLGSLARTLHVGPLADC
FT                   FFDPATALCLNRSSEPGASGPMISMCEPVRCPNACIAERHRPAWQRGADEARLLLREKR
FT                   LPEPQRVTLQAEVARIQRVLEQIAPGTATPHNGMAGEEEEAGLRVTD"
     atgaccgttg tccagcttct ggcggagagc gacgatgagc gcgatgccct ccctgtgctt        60
     atgtccgcgc ctttgcgccc cggctgcgat cgcgcgcata tttcacgata cggcgatcca       120
     gtgtgggatc tggctcccgg cgtatttcgc gacaacgcgc ggcgctgcca tgtcacggta       180
     catttcggcg gtatcaaaga cccatccatt gctgatgccc tgcgccagat tctccatgcg       240
     cggctcaatg tcgatctccc cggtcaccgt tcgcggcttg agccggccgg ggtgcgcggc       300
     gaggccaacc ggaccttgcg ctttttcgac ttcgtcaagg ctcagctggg gcgtttcgat       360
     ctcgcccggg tcgatcaggc tctggtcgat cgctacgccg gagccttgcg cctagccggg       420
     ctgcgcccag ttgcagcggc agcgctgctg cggatcgtct ttgacctgca cgagttgcag       480
     catcatctgc cgactgcgcg cctgtccttc gaaccgtggc cgggacgaag tccgttttcc       540
     gtggcgggcg caaagcatat tgcaggggag aaccggacgc cgcgcattcc tgaagcgatc       600
     atgacgccgc tgctctcctg gtcgttgcgc tacgtgacct gctacgcagg cgatatcctt       660
     gccgcacggg cagaactcga ttgccttgaa gcaacgcgca accgtctgat tgccgctgag       720
     gaaggtctgg atcccgctgt tcgtcggtta cggcaacgcc aacgcctcct cgactatgtt       780
     gcatccttgc ggcagcatgg gcgcggcatt ccgatctgga ccacggcaca taacggcgca       840
     acgcgaacag atccgcaaac cggcgccgtc acgccgccga tcaactacca cctgatccac       900
     ctccatgccg gtatcaacgc gcaggccgaa cctgccatgc accttggcct ggccacgggt       960
     gcaccagacc tcatcgccgc tgccatcgca gaactcggca ccgagattgg cggcatggat      1020
     acgcccaatt ctgccgatcc cgatacgggc atgccttggc gcacccgctt cgatgccaag      1080
     gttttgcccc tcgaggaagt catgctgcag tccgcagcct atatcgtatg tgcctttctc      1140
     tcaggcatgc gggacagcga gatccaagcc atgaggcggg gatgcctgtc tattaccaaa      1200
     gccgaagacg gtacgatctt gcggcatcgt atcaagtcca ctgcttacaa gggcaagcgc      1260
     ggcggcggcg aggagaccga gtgggttacc atcgcgccgg tcgctgaagc catcgatgtc      1320
     ctcgaacgcc tttccgcgcg ggcgggacaa gcgcgcggaa caacgaccct gtggccagtc      1380
     ctcacgcttc gggccaatac caagacgcac gtctctgcag agatagtccg gcaactcaac      1440
     cggttccgcg atcacctcaa tgaccacttc ggatccgcgc aggcacccgt cattcctgcc      1500
     ggacccgacg gccgaccatg gcgtctgaca acgcgtcagt ttcgccgcac aatcgcctgg      1560
     cacatcgcca accggccctt cggaacaatt gccggcatga tccagtacaa gcatgcgagc      1620
     gttgcggctt tcgaaggcta tgctggcagc agccggtccg gatttcgggg agagatcgaa      1680
     gcccagcgtg cgcttggcca gattgacgat atccttgtct acttcgacga gcggcaaagt      1740
     ggcgcacgcc ttggcggacc tgccgcgaac agggtcggag ttgtgcttga tactgccgcc      1800
     cacgagttgg cgccgctacc tgccatgatt gccgaccgtc cacgtctgcg caccatgctg      1860
     ggcagtctcg cgcggacatt gcatgtcggc ccgctggccg attgcttctt tgatccggca      1920
     accgccctgt gcctgaaccg gagttcggag ccaggcgcaa gcgggccaat gatctccatg      1980
     tgcgaaccgg tccgctgccc caatgcctgc atcgccgaac ggcatcgccc ggcatggcag      2040
     cgcggtgctg atgaggcacg gttgttgttg cgcgagaagc ggcttccaga gccgcagcgg      2100
     gtgacgcttc aggccgaggt ggccagaatc cagcgtgttc ttgaacagat cgcaccgggt      2160
     accgccacac cgcataacgg tatggcggga gaggaagagg aggcgggttt gcgggtgacg      2220
     gattga                                                                 2226
//

If you have problems or comments...

PBIL Back to PBIL home page