(data stored in ACNUC7421 zone)

EMBL: AP010803.PE421

AP010803.PE421       Location/Qualifiers
FT   CDS_pept        439958..440860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_C1-04210"
FT                   /product="antirestriction protein ArdC"
FT                   /note="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95255"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY23"
FT                   /protein_id="BAI95255.1"
FT                   /translation="MSRSYPATPRADVYSRITTEIVSAIEAGAGDWRMPWHHDGAATTR
FT                   PQNVTSRRRYRGVNVLALWIAAEAAAYSSGLWGTYRQWASLGAQVRKGERGTTVVFWKQ
FT                   AASRADDDHDDGEAGPGRMFARAFTVFNLAQVEGYEPPPVAVLPEGERFGHAEAFVAAL
FT                   KIPITEGAYDAHYRIDLDHIFMPTFASFRDASAQMGTLLHEAAHATGAKHRLDRNFAER
FT                   FKRDSLAIEEICAELTASFVLADLRIAHHPRADHAAYVASWLRALKDDPRAIFTAASKA
FT                   QAAADWMHAQQPQPEEIAA"
     atgtcccgat cctaccctgc gacgccgcga gccgacgttt attcgcgcat caccaccgag        60
     attgtatctg ccatcgaagc cggggccggc gattggcgca tgccctggca ccatgatggc       120
     gctgccacca ccaggccgca gaacgtcacc tctcgccgcc gctatcgcgg cgtcaacgtg       180
     ctcgcgctct ggatcgcagc cgaagcggct gcctattcca gcggtctttg ggggacctat       240
     cgccagtggg catcgcttgg cgcacaggtc cgcaaaggtg aacgcggaac gacggttgtg       300
     ttctggaaac aggccgcatc gcgcgccgat gatgatcatg acgatggcga agccggaccc       360
     ggccgcatgt tcgcgcgggc cttcaccgtg ttcaacctcg cccaggtcga gggctatgaa       420
     cccccacctg tcgcagttct acccgagggc gagcggttcg ggcacgccga agctttcgtc       480
     gcggccctca agatcccgat caccgagggc gcctacgatg cgcactaccg gatcgacctc       540
     gatcacatct tcatgccgac ctttgcctcg tttcgggatg catcagcaca gatgggcacg       600
     cttttgcatg aggcggccca cgccacaggg gcaaagcacc ggctcgaccg caactttgcc       660
     gaacgtttca agcgcgacag cttggcgatc gaggaaattt gcgctgaact gaccgcatcg       720
     ttcgtactcg ccgacctcag gatcgctcac catccgcggg ccgatcatgc cgcctacgta       780
     gcatcgtggt tgcgcgcact caaagacgac cctcgcgcca tcttcaccgc cgccagcaag       840
     gcgcaggcgg ccgccgattg gatgcacgcc cagcagcccc agcctgagga gatcgccgca       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page