(data stored in SCRATCH zone)

EMBL: AP010803.PE422

AP010803.PE422       Location/Qualifiers
FT   CDS_pept        440857..441138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_C1-04220"
FT                   /product="antirestriction protein ArdC"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95256"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY24"
FT                   /protein_id="BAI95256.1"
FT                   /translation="MISAPKICGRSHIRAGLSGYVAELTAALVGADVGLPTTHLDDHAA
FT                   YIGSWLAILRKDNRALLTAAARAEEAAGFLLRATDLACEDDLDEQAAA"
     atgataagcg ccccgaaaat ttgcggtaga agtcacatta gggctggact gtcaggatat        60
     gtcgccgaac tgacagcagc gctggttggc gccgatgtgg gtctcccaac cacccatctc       120
     gacgaccacg cggcttatat cggatcctgg ctcgccattt tgcgcaagga taatcgcgca       180
     ttgctgacgg cggctgcgcg agccgaggaa gccgccgggt ttctgctgcg ggcaaccgat       240
     ctcgcttgcg aggatgatct ggacgagcag gcggctgctt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page