(data stored in ACNUC7421 zone)

EMBL: AP010803.PE425

AP010803.PE425       Location/Qualifiers
FT   CDS_pept        442075..442515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="SJA_C1-04250"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="arsenate reductase or related protein, glutaredoxin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95259"
FT                   /db_xref="GOA:D4YY27"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY27"
FT                   /protein_id="BAI95259.1"
FT                   /translation="MSNAAIDIVIYHNPECGTSRNTLAMIRNAGIEPHVIEYLKTPPNR
FT                   PRLVSLIARMGISARQLLREKGTPFAELGLADPTLSDDQLIDAMIEHPILINRPIVVSP
FT                   LGVKLCRPSEEVLDLLPSAQRGAFTKEDGEQVIDAAGKRIGA"
     atgagcaatg ccgcaatcga tatcgtcatc tatcacaatc ccgagtgtgg gacgtcgcgc        60
     aacacgctgg cgatgatccg caacgccggg atcgagccgc atgtgatcga atatctcaag       120
     acgccgccca accgcccgcg cctggtttcg ctcatcgccc gcatgggcat cagcgcacgc       180
     cagttgctcc gcgagaaggg cacgcccttc gccgagctgg gtcttgccga tccgacgctc       240
     agcgatgacc agctcattga tgcgatgatc gaacatccga tcctcatcaa ccggccaatc       300
     gttgtgtcgc cgctcggcgt gaaactctgc cgtccatcgg aagaggtgct cgatcttctc       360
     ccgtccgccc agcgcggggc tttcaccaag gaagatggcg agcaggtcat cgacgccgcc       420
     ggcaagagga tcggggcgtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page