(data stored in ACNUC7421 zone)

EMBL: AP010803.PE429

AP010803.PE429       Location/Qualifiers
FT   CDS_pept        444894..446036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95263"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY31"
FT                   /protein_id="BAI95263.1"
FT                   /translation="MGHRAGGGNPNAPAVLARRGAPARTTRTLSGSPWALPGGAAAAFS
FT                   MARRVRIRREGRRPCDTERQSLMTSSLSAVLQALELGHLDLMGDQRSMEAPPPAEALEQ
FT                   TVSAIWSDLFALFPFTALERDIEDLGWGFVNLFHRAAAKKHQLIDRLTDEIRLLLAEQD
FT                   GSEIATADLEDKIDLARKVEQSAQAYEGMRDTAARHYLHETGRSWVPATGNRISLGTTA
FT                   AIVDGRAYLQARRERVRDANMVHGTPVVFAGGRLRFASDDEAKQFADNLLRTLKAVRER
FT                   VGDMYLVHGGDMKGIERLAASWAEQNGIQQLRFGLDRKLGDRAGFRRNEQMLSVKPRYV
FT                   IAFQGNGVTERLVVEAKARGIHVVDRRGPLGTPPAALSRG"
     atgggccatc gcgctggcgg cggcaacccg aacgctccgg ccgtgttggc gcgccgaggc        60
     gcgcctgccc gcaccacccg gaccttatcg ggttcccctt gggcgttgcc cggcggtgcc       120
     gccgccgctt tttcgatggc ccggagggtg cgcatccggc gggaaggccg ccggccctgc       180
     gacacggaaa ggcaatccct catgaccagc tccctttcag cagtgctcca agcactcgaa       240
     ctcggccatc tcgacctgat gggcgaccaa cgctcgatgg aagcgccgcc gccggccgaa       300
     gcgctcgaac agaccgtcag cgccatctgg agcgatctct tcgcgctctt ccccttcacc       360
     gcgctcgaac gcgacatcga ggatctgggc tggggcttcg tcaatctctt ccaccgcgcg       420
     gccgccaaga agcatcagct gatcgaccgc ctgaccgacg agatccggct cctgctcgcc       480
     gagcaggacg gatcggagat cgcgaccgct gatctcgagg acaagatcga tctcgcccgc       540
     aaggtcgagc agtccgccca ggcctatgag gggatgcgcg acaccgcggc gcgccactat       600
     ctgcatgaga ccggccgctc ctgggtgccc gcgaccggca accgcatctc gctcggcacg       660
     accgctgcga tcgtcgatgg ccgggcctat ttgcaggcgc ggcgcgagcg ggtgcgcgat       720
     gccaatatgg tccatggcac gcccgtggtc ttcgccggcg ggcgccttcg cttcgccagc       780
     gacgacgagg ccaagcagtt tgccgacaat ctgctgcgga ccctcaaggc cgtgcgcgaa       840
     cgtgtgggcg acatgtatct cgtccatggc ggtgacatga agggcatcga gcgtcttgca       900
     gcatcctggg ccgagcagaa cggcatccag cagctgcggt tcggccttga tcgcaagctt       960
     ggcgatcgtg ccggcttccg gcgcaacgag cagatgctct cggtcaagcc gcgctacgtc      1020
     attgccttcc agggcaacgg cgtcaccgaa aggctggtgg tcgaggccaa ggcgcgcggc      1080
     atccatgtcg tcgatcgccg cggaccgctc ggaacgccgc cggcggcttt atctcgcggc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page