(data stored in ACNUC7421 zone)

EMBL: AP010803.PE43

AP010803.PE43        Location/Qualifiers
FT   CDS_pept        complement(45319..45771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94877"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ5"
FT                   /protein_id="BAI94877.1"
FT                   /translation="MMVRRLSSRLSAGLLLAALLPLAACGGGAKDRPKADLAASKVTTI
FT                   GVNAYLWRASLDTLSFMPMVQTDSNGGVIVTDWYANPNSPNERMKLTVSILDQDLRADA
FT                   LRVAASRQVSQGGQWVDVPVQAATVQKLEEIILTKARDLRRMAIAG"
     atgatggtcc gccgcctttc ttcgcgcctt tccgccggtc tgctgctggc tgcactcctg        60
     ccgctcgccg cctgcggggg cggcgccaag gaccgcccga aggcggacct cgccgcatcg       120
     aaggtgacga ccatcggcgt caacgcctat ctgtggcgcg ccagcctgga cacgctgtcc       180
     ttcatgccga tggtgcagac ggattcgaac ggcggcgtga tcgtcaccga ctggtacgcc       240
     aatccgaaca gccccaatga gcggatgaag ctgaccgtat cgatcctcga ccaggatctg       300
     cgcgccgacg cgctgcgcgt cgcggccagc cgccaggtca gccagggcgg ccagtgggtc       360
     gacgtgccgg tgcaggccgc aacggtgcag aagctggagg agatcatcct gaccaaggcc       420
     cgcgatctcc gccgcatggc gattgctggc taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page