(data stored in ACNUC7421 zone)

EMBL: AP010803.PE432

AP010803.PE432       Location/Qualifiers
FT   CDS_pept        447225..447632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04320"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95266"
FT                   /db_xref="GOA:D4YY34"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY34"
FT                   /protein_id="BAI95266.1"
FT                   /translation="MQNLVILAGNVGGTPETRTTQGGTRITHFSLATSRPKRDSNGKIL
FT                   RDDNNRRLEDTEWHRITCFNGVGKTVEQYVDKGMKVMVRGRIHYTRWTDSENIERYGVE
FT                   IIADEVTFLTRAKSNENSGGGNEPEDDEIPF"
     atgcagaacc tcgtcatcct cgccggcaat gtcggtggca cgccggaaac ccgcaccacc        60
     cagggcggca cccgcattac ccatttcagc ctcgccacct cgcgcccgaa gcgcgacagc       120
     aacggcaaga tcctgcgcga cgacaacaat cgccgcctcg aggacaccga atggcaccgg       180
     atcacctgct tcaacggcgt cggcaagacg gtcgagcaat atgtcgacaa gggtatgaag       240
     gtcatggtcc ggggccgtat ccactacacc cgctggaccg acagcgagaa tatcgaacgc       300
     tacggcgtcg agatcatcgc cgacgaggtg accttcctca cccgcgccaa gtccaacgag       360
     aatagcggcg gcggcaacga gcccgaagac gatgaaatcc ccttctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page