(data stored in ACNUC7421 zone)

EMBL: AP010803.PE433

AP010803.PE433       Location/Qualifiers
FT   CDS_pept        complement(447708..448142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95267"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY35"
FT                   /protein_id="BAI95267.1"
FT                   /translation="MLFPLLLAAAVVPNGQTFACTPTRVWDGDGPIWCREGAHVRLAGI
FT                   AAREIDNSCRPGQPCPRASGPAARDALVRLLGGPRGQTSTGHIRVAGPTMRCVSTGEAK
FT                   GNRTGAWCNAPGIGDLSCAMIATGTVLRWERYAKGRCRSR"
     atgctgttcc cgctcctgct tgccgccgcc gtcgttccta atggtcagac cttcgcctgt        60
     acgccgacgc gcgtctggga tggcgatggc cccatctggt gccgcgaggg cgcccatgtg       120
     cggctcgccg gcattgccgc gcgcgagatc gacaacagct gccgccccgg ccagccctgt       180
     ccgagagcaa gtggcccggc cgcccgcgat gcgttggtgc gcctgcttgg cggaccgcgc       240
     ggccagacat ccaccgggca tattcgcgtg gctggcccca ccatgcgctg cgtctcgacc       300
     ggcgaagcca agggcaaccg gaccggcgcc tggtgcaacg cgcccggcat cggcgatctc       360
     agctgcgcga tgattgcgac cggcaccgtg ctgcgctggg agcgctatgc caaggggcga       420
     tgccgatccc gctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page