(data stored in ACNUC7421 zone)

EMBL: AP010803.PE434

AP010803.PE434       Location/Qualifiers
FT   CDS_pept        448371..448613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95268"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY36"
FT                   /protein_id="BAI95268.1"
FT                   /translation="MIAATGRTHRAPVERDEPAGAQRSLDMFTDIAIARRHAFSLSRSL
FT                   MMVTFVIAIGQHYGVITAEDADGSVAIVTEFDPFA"
     gtgatcgcgg ccaccggccg gacacatcgg gcgcctgtcg agcgggacga acccgccggc        60
     gcgcaaagga gcctcgacat gttcaccgac atcgcaatcg ctcgccgcca cgccttcagc       120
     ctctcgcgca gcctcatgat ggtcaccttc gtcatcgcga tcggtcagca ttacggggtc       180
     atcaccgccg aagacgccga cggcagcgtc gccatcgtca ccgaattcga tccctttgcc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page