(data stored in ACNUC7421 zone)

EMBL: AP010803.PE435

AP010803.PE435       Location/Qualifiers
FT   CDS_pept        448691..449242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95269"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY37"
FT                   /protein_id="BAI95269.1"
FT                   /translation="MFRCRAYAAIMTIEAAIANAGDDALWARVTQEVNAWRGACLQCFA
FT                   AVEVAVTETLLHLSAQPGRGQSVKLRHLVGQRLDDLAALVNEGGPFSVEGKGVASLLAE
FT                   FRHQEGLRTMLAHGQAKLTVERTSRWAAIFRVIAIRARQADRSTLVIEESEAVERPQQL
FT                   RKVSQKLCSALGNLRRAVAV"
     ttgttcagat gccgcgccta tgctgcgata atgacgattg aggctgcgat agcgaatgcc        60
     ggcgatgatg ccctgtgggc gcgcgtcacc caggaggtga acgcctggcg cggtgcctgt       120
     ctgcaatgct tcgccgcggt ggaggtggcc gttaccgaga ctttgctgca tctgagcgct       180
     cagccgggac gaggacagtc ggtgaagcta cggcatttgg tcgggcaacg gctcgatgac       240
     cttgctgcac tcgtcaatga gggcggcccc ttttccgtgg agggaaaggg tgtcgcgagc       300
     ctgctggcgg aatttcggca ccaggaaggg ctgcgcacga tgctcgccca tggccaggcg       360
     aagctgacag tcgaacggac cagtcgatgg gccgccatct ttcgtgtgat cgcgatccgg       420
     gcacggcagg ctgatcgttc gacgctcgtg atcgaagaga gcgaggcggt ggagaggcct       480
     cagcagctcc gtaaggtatc gcagaaattg tgctctgctc ttggcaattt gcgccgggcg       540
     gttgccgtct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page