(data stored in ACNUC7421 zone)

EMBL: AP010803.PE436

AP010803.PE436       Location/Qualifiers
FT   CDS_pept        449457..449684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95270"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY38"
FT                   /protein_id="BAI95270.1"
FT                   /translation="MLIVQHYVPGTVMAARREIISRAVAADHAASDLPVDEAGACSMEP
FT                   DQGIDILAHQGTAAAALRSDEDLAQPHRLE"
     gtgctcatcg tgcagcatta tgtgccaggg acggtcatgg ccgcgcgccg cgagataata        60
     agccgcgccg tcgcagccga ccatgcggca tcggacctgc cggtcgatga ggctggcgcc       120
     tgctccatgg agcccgatca gggcatcgac atcctcgcgc atcaaggcac cgcagcggcg       180
     gcattgcgat cggacgagga tctggcgcag ccgcatcgcc tggagtga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page