(data stored in ACNUC7421 zone)

EMBL: AP010803.PE437

AP010803.PE437       Location/Qualifiers
FT   CDS_pept        449992..450384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95271"
FT                   /db_xref="GOA:D4YY39"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY39"
FT                   /protein_id="BAI95271.1"
FT                   /translation="MSQSSPNAMSQAERIARVAELNDALRRSIHSPGRNQIVMTAGVAA
FT                   LIGDVALFRGFRRRAEIIRIVRDYDSFTPDNDPVGEHDFGRFEFEDAILYWKIDYYDLE
FT                   LAYGSADAAKPEVTTRVLTILLADEY"
     atgtcccaat cctccccgaa tgcgatgagc caggccgagc ggatcgcccg cgtcgccgaa        60
     ctcaatgacg cgcttcgccg gtccatccat agcccgggcc gtaaccagat cgtgatgacc       120
     gctggcgttg cggcgctgat cggcgacgtc gccctgttcc gcggctttcg ccgccgcgcg       180
     gagatcatcc ggatcgtgcg cgactatgac agcttcacgc ccgacaacga tccggtcggc       240
     gagcatgatt tcggccgctt cgagttcgag gatgcgatcc tctactggaa gatcgactat       300
     tacgacctcg agctcgccta tggctcggcg gatgctgcga aacccgaggt cacgacgcgc       360
     gtgctcacca tcctgctggc cgacgaatat tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page