(data stored in ACNUC7421 zone)

EMBL: AP010803.PE438

AP010803.PE438       Location/Qualifiers
FT   CDS_pept        450577..450753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95272"
FT                   /db_xref="GOA:D4YY40"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY40"
FT                   /protein_id="BAI95272.1"
FT                   /translation="MAAYFAAHPDHAFLFAFGCFALTVYLFRYVGPGIGGGGDWSSRDH
FT                   YERNLRDGPDDYC"
     atggccgcat atttcgccgc gcatcccgat cacgcgtttc tcttcgcgtt cggctgcttc        60
     gccctcaccg tctatctgtt ccgctatgtc ggtcccggca ttggcggtgg cggcgactgg       120
     tcctcgcgcg atcattatga gcgcaacctg cgcgatggtc cggacgacta ttgctga          177
//

If you have problems or comments...

PBIL Back to PBIL home page