(data stored in ACNUC7421 zone)

EMBL: AP010803.PE439

AP010803.PE439       Location/Qualifiers
FT   CDS_pept        450766..451530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04390"
FT                   /product="ParA-like protein"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95273"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY41"
FT                   /protein_id="BAI95273.1"
FT                   /translation="MKTIVVSLLKGGVGKTFLATHLAWYLAEPPERRVAFVDLDPQGSS
FT                   TRRLGAERQGGFAADLFDPAATLCADGQAGLTVLGADPRLQMVKAAQDVRDFIGRFPAL
FT                   RPHFDYCVIDTGPKWDELTLSAMAVADAVIAPVQVAEDSVQCAKMLLTALRKAEAARAG
FT                   RKIAFLGLLPSMVNPFDRREMENAVKLAHAVGEKLMFPAFIKARPTYKHAAENHRPVWQ
FT                   ETGSGAKAAAEEIRAVLAEIERRMTSQEVAAA"
     atgaagacga tcgtcgtcag cctgctcaag ggcggggtcg gcaagacctt cctcgccacc        60
     catctcgcct ggtatctcgc cgaaccgcct gagcgccgcg tcgccttcgt cgatctcgat       120
     ccccagggca gctcgacgcg gcgcctgggc gccgagcggc aaggcggatt tgccgccgac       180
     ctgttcgacc ctgccgctac cctgtgcgcc gatgggcagg ccgggctgac cgtgctcggc       240
     gccgatcctc gcctccagat ggtcaaggcg gcgcaggatg tgcgggactt catcgggcgc       300
     ttcccggcgc tccgcccgca tttcgactat tgcgtcatcg acacggggcc gaagtgggac       360
     gagctcacct tgagcgcgat ggcggtcgcc gatgccgtga tcgcgccggt gcaggtggct       420
     gaggattcgg tccaatgcgc caagatgctg ctgaccgcgc tgcgcaaagc cgaggccgcg       480
     cgcgccggcc gcaagatcgc tttcctcggg ctcctcccct cgatggtcaa tccgttcgac       540
     cggcgcgaga tggagaatgc ggtgaagctc gcgcatgcgg tcggcgagaa gctcatgttc       600
     ccggccttca tcaaggcacg gccgacctac aagcatgccg cggaaaatca tcgtccggta       660
     tggcaggaga ctggcagcgg cgccaaggct gcggccgagg agatccgcgc ggtgctcgct       720
     gagatcgagc ggcgcatgac aagccaggag gtcgcggccg cctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page