(data stored in ACNUC7421 zone)

EMBL: AP010803.PE44

AP010803.PE44        Location/Qualifiers
FT   CDS_pept        45996..46727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94878"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ6"
FT                   /protein_id="BAI94878.1"
FT                   /translation="MRLKRGHIALAGSAVAVAGFMLSPAIGAAADLVRMRAETPVSLGA
FT                   LGSISSFTPTTKDPRLAAAYAKIAASASRQNFRFTPTSGSLSGQRSVTVMVRAADLNDR
FT                   VAVSRTLDPVNIAPVAFSLNSAHNWRKFALPEAVGRKELDPVAVEPMAGARNFSLDQGR
FT                   KDRFSTKVLIESRREPAATIRNPSADKDYSLDLASSYSLTRNLNVTAGVRYNNSFAGRL
FT                   TPMTDDRQDAQAVYLGTIFKF"
     atgcgcctga aaaggggaca tatagcgttg gcaggctcgg cggtcgccgt ggccggcttc        60
     atgctgtctc ctgccatcgg cgcggccgcc gacctggtcc gcatgcgcgc cgaaaccccg       120
     gtttcgctgg gcgcccttgg cagcatatcc tccttcacgc cgacgaccaa ggatccgcgc       180
     ctggcggccg cctatgcgaa gatcgccgca tccgcgagtc gccagaattt ccgcttcacc       240
     cccaccagcg ggtcgctgag cggccagcgt tcggtcacgg tcatggtgcg cgccgccgac       300
     ctgaacgatc gcgtggcggt cagccggacg ctggacccgg tgaatatcgc gccggtcgcc       360
     ttcagcctga acagcgcgca caactggcgc aagttcgccc tgcccgaagc ggtgggccgc       420
     aaggaactgg acccggtcgc ggtggagccg atggccggcg ccaggaattt ctcgctggac       480
     cagggccgca aggaccgttt cagcaccaag gtgctgatcg aaagccgccg cgaaccggcc       540
     gcgacgatcc gcaaccccag cgcggacaag gattattcgc tggatctggc gagttcctat       600
     tcgctgacgc gcaatctgaa cgtcacggcg ggcgtgcgct ataacaacag cttcgccgga       660
     cgactgacgc cgatgaccga cgaccggcag gatgcgcagg ccgtctatct gggcacgatc       720
     ttcaaattct aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page