(data stored in ACNUC7421 zone)

EMBL: AP010803.PE440

AP010803.PE440       Location/Qualifiers
FT   CDS_pept        451530..452477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04400"
FT                   /product="ParB-like protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95274"
FT                   /db_xref="GOA:D4YY42"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR042075"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY42"
FT                   /protein_id="BAI95274.1"
FT                   /translation="MGKFDERIEEFGLLVGGHERARRVEDIELARILPDPGNPRRSFDD
FT                   DALAELASSIASRGVLQPITVTPPDANGMHRIRLGERRFRASQLAGLATIPAIVVPVGE
FT                   GVQLLADQIVENDQRANLSSVELAHAIARMLKGGMNQVEIAAALGRSKQFVSLYAAYGD
FT                   MPAYLKEALPFAPIRLLYDLHRTARDYPAEVEAYVASWGDAGATLAAGSRFIAELKQTH
FT                   PAPVPPRAPVAKPLGPTDRDPVRSGLTDKPSAPIRSPRLPVLVDGFPAWLPLAPLVTVI
FT                   FEDGREREVAASSIGPTGERSEALPTTDPPPPRS"
     atgggcaagt tcgacgaacg catcgaggag ttcggacttc ttgtcggcgg ccatgaacgg        60
     gcgcgccggg tcgaggatat cgagcttgcg cgcatcctgc ccgaccccgg caatccccgg       120
     cgcagcttcg acgatgacgc gctcgctgag ctggcctcct cgatcgcgtc gcgcggcgtg       180
     ctgcagccga tcacggtcac gccgcctgac gcgaacggca tgcaccggat acgtctgggc       240
     gagcgccgct tccgcgcatc gcagctggcg ggccttgcca cgattcccgc gatcgtcgtg       300
     ccggtcggcg agggggtgca actgctggcc gaccagatcg tcgagaatga ccagcgcgcc       360
     aatctgtcgt cggtcgagct cgcccatgcg atcgcccgga tgctcaaggg cgggatgaac       420
     caggtcgaga tcgcggcggc actcggccga tccaagcagt tcgtctcgct ctatgccgcc       480
     tatggcgaca tgccggccta tctcaaagag gccctgccgt ttgcgcccat tcgccttctc       540
     tatgatctgc accggacggc gagggactac cctgccgagg tcgaggccta tgtcgccagc       600
     tggggcgacg ccggggcaac gctcgccgca ggatcgcgct tcatcgccga actcaagcag       660
     acgcacccgg cgccggtccc tccgcgggcg cctgtggcaa agccattggg gcccaccgac       720
     cgcgatccgg ttcgatcggg cctcacggac aaaccctccg cgccgatccg atctccgaga       780
     ctaccggttc tggtcgacgg attccctgcg tggctcccgc tggcgccttt ggtcacggtg       840
     attttcgagg atggccgcga gcgggaggtc gctgcctcgt caatcggtcc gaccggcgag       900
     agaagcgagg ccttgccaac aactgacccg cctcctccgc gttcgtaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page