(data stored in ACNUC7421 zone)

EMBL: AP010803.PE441

AP010803.PE441       Location/Qualifiers
FT   CDS_pept        452683..453243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04410"
FT                   /product="putative mobilization protein"
FT                   /note="GTPase SAR1 or related small G protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95275"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY43"
FT                   /protein_id="BAI95275.1"
FT                   /translation="MYDNSVGDMPVLTFRLDDDVAQRFAALAAASGGRSALLRRLIGDA
FT                   LAMEAGEGHQAPRARQRATCRVEVRLIPEEIAALDREADALGMKRTDWITTLLARRLRA
FT                   NAPLPREERAAVAQAWRELNRIGINLNQATRALNASVMVESGLDVAREAARVASFRSEI
FT                   VDALAGLGAALKGDLRYWDMADA"
     atgtatgaca atagcgttgg ggacatgccc gtcctcacct ttcggctcga cgatgatgtc        60
     gcccagcgct tcgccgcgct cgcggcggca tcgggcggcc gctcggcgct gctgcgccgc       120
     ttgatcggtg acgccttggc catggaggcg ggggaggggc atcaggcgcc gcgcgcccgc       180
     cagcgggcaa cctgccgggt cgaagtgcgg ctgatccccg aagaaatcgc cgcgctcgac       240
     cgcgaggcgg atgcgctggg gatgaagcgc accgactgga tcaccacgtt gctggcgcgg       300
     cgattgcgcg cgaacgcgcc cttgccgcgc gaggagcgag cggccgtcgc gcaagcctgg       360
     cgcgaactca accggatcgg gatcaatctc aatcaggcga cccgcgcgct caatgcctcg       420
     gttatggtcg aatccgggct cgacgtcgcg cgggaagctg ccagggttgc aagctttagg       480
     tccgagatcg ttgatgcgct ggccggtctc ggtgccgcgc tcaagggcga ccttcgctac       540
     tgggacatgg ccgatgcgtg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page