(data stored in ACNUC7421 zone)

EMBL: AP010803.PE443

AP010803.PE443       Location/Qualifiers
FT   CDS_pept        454528..455136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04430"
FT                   /product="hypothetical protein"
FT                   /note="polyketide synthase module or related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95277"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY45"
FT                   /protein_id="BAI95277.1"
FT                   /translation="MSAVADRIMKRVRGKGRGWVFTPKSFVDFGTRGSVDMALSRLASA
FT                   GDIRRIGRGLYDYPRQHDKLGALSPDPANVAKALSTQSGDKLAPSGATAANNLGLSTQV
FT                   PARASYATTGRSRVRQAGGRSLTLKHSRAPVLDNAPDSVNAIVQALAHLGKDNIDSGKI
FT                   RHFATRLDDRDMRILIQARPAMPGWMGDVVLKIGAARNG"
     atgtctgcgg tagccgatcg gatcatgaag cgtgtgcgcg gcaagggccg cggctgggtg        60
     ttcacgccca agagcttcgt cgacttcggc acgcgcgggt cggtcgacat ggcgctgtcg       120
     cgcctcgcga gcgctggcga catccggcgc atcggccgag gcctttatga ctatccacgc       180
     cagcatgaca agctcggcgc gctcagtccc gatcccgcca atgtcgccaa ggccctctcg       240
     acgcagagcg gggataagct tgcgccgtcc ggagcgacgg cagccaacaa cctcggcctc       300
     tcgacccagg tgccggcccg ggccagctat gccacaaccg ggcggtcccg ggtcaggcaa       360
     gcgggcgggc gcagcctgac gctcaaacac agccgcgcac cggtgctcga caatgcgcct       420
     gactcggtca acgcaatcgt gcaggcgctc gcgcatctgg ggaaggacaa tatcgacagc       480
     ggcaagatcc ggcacttcgc aacgcggctc gatgatcgcg acatgcggat cctcatccag       540
     gcccggccgg cgatgcccgg atggatgggc gacgtcgtct taaagatcgg cgccgcccgc       600
     aatggatga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page