(data stored in ACNUC7421 zone)

EMBL: AP010803.PE444

AP010803.PE444       Location/Qualifiers
FT   CDS_pept        455129..456178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95278"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY46"
FT                   /protein_id="BAI95278.1"
FT                   /translation="MDEFARRPAEDRRAYIDEAAARRDLTPIIIEKDFWVCWTLRRLIM
FT                   CPDLVGHMTFKGGTSLSKAYGIIARFSEDIDLTISRSAPLLDKVASPMDDDITGKERER
FT                   RTKALKAAAQAYVATVAMPILAREIETALGTGEGWSLALDPDDKDQQTLLFVYPRSSGY
FT                   GLAYGENYGGADESGYIKPRIKLEFGARGDTEPFELRPISSYLTEDFPEELPNALTEVP
FT                   TLAVARTFWEKVTILHAIHHNGKLREGMSRHYYDVLMLDQAGITAEALARITLLEQVVH
FT                   NKSLMFADKSASYETAVPGTLRLSPDGATQEKLERDYGAMSEMFMAAPPKFDALMKGLA
FT                   AIEAAINGR"
     atggatgagt tcgcgcgcag acccgccgag gaccggcggg cctacattga tgaagccgcc        60
     gcgcggcggg acctcacgcc catcatcatc gagaaggatt tctgggtctg ctggacgctg       120
     cgccgcctga tcatgtgccc cgaccttgtc ggtcatatga ccttcaaggg cggaacgtcg       180
     ctgtcgaagg cctatgggat cattgcgcgg ttctccgaag atatcgacct caccatcagc       240
     cgctcagcgc cgctgctcga taaggtcgcg tcgccgatgg acgacgacat taccggcaag       300
     gagcgcgaac gccggaccaa ggcgctcaag gcggcggcgc aggcctatgt cgcgaccgtc       360
     gcaatgccga tcctcgcccg cgaaatcgag accgctctcg gcaccggcga gggctggagc       420
     ctcgcccttg atcccgacga caaggaccag cagacgctgc tcttcgtcta cccgcgcagt       480
     tcgggctacg ggctcgccta tggcgagaat tacggcggtg cggacgaaag cggctacatc       540
     aagccgcgca tcaagctcga atttggcgcc cgcggcgata ccgaaccgtt cgagctccga       600
     ccgatatcat cctatctgac cgaggacttt cccgaggagt tgccgaatgc gctgaccgag       660
     gtgccgacgc tcgccgtcgc gcggaccttc tgggaaaagg tcacgatcct tcatgcgatc       720
     catcataacg gcaagctacg cgagggcatg tcgcgccatt attatgacgt gctgatgctt       780
     gaccaggccg gcatcacggc cgaggcgctg gcgcggatca cgttgctcga gcaggtcgtg       840
     cacaacaaga gcctgatgtt cgccgacaag tcggcatcct acgagacggc cgtgcctgga       900
     acgctgcgcc tgtcgcctga tggcgccacc caggaaaagc tcgagcgaga ctatggcgcg       960
     atgtctgaga tgttcatggc cgcgccgccg aaattcgatg cgctgatgaa agggctggcg      1020
     gcgatagagg cggcgatcaa cgggcgctaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page