(data stored in ACNUC7421 zone)

EMBL: AP010803.PE447

AP010803.PE447       Location/Qualifiers
FT   CDS_pept        459180..459383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95281"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY49"
FT                   /protein_id="BAI95281.1"
FT                   /translation="MITAKHIPWEPIATLPEDRKDGRRLLLWEVDLPVIGRWDSDREGW
FT                   EDPESMHILEEVTHWADINPPV"
     atgatcaccg ccaagcacat cccttgggag ccgatcgcga cattgccgga agaccggaaa        60
     gatggccgtc gcttgctgct ctgggaggtt gacctccctg tgatcgggcg atgggatagc       120
     gaccgcgaag gctgggagga tcccgaaagc atgcatatcc tagaagaagt cacccattgg       180
     gctgacatca atccacccgt gtga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page