(data stored in ACNUC7421 zone)

EMBL: AP010803.PE45

AP010803.PE45        Location/Qualifiers
FT   CDS_pept        complement(46806..47300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00450"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94879"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ7"
FT                   /protein_id="BAI94879.1"
FT                   /translation="MPLALLYALAGCGSDETPAANIAQPHASTPIAMPAPTLRQGTENR
FT                   AKTVPRETGERSPVGAPPVKHYADDDYRAIGTEPFWAVTVNGSTAVLERPDKAPVRYAI
FT                   TRNDDKRALRFLGEGFSMTVTEGPCSDGMSDALWSDRVAVAFGEGTLNGCGGLRDDLDE
FT                   P"
     ttgccgctgg ccttgctata tgcgctggcg gggtgcggca gcgatgagac gcccgcagcc        60
     aatatcgcgc agcctcacgc ctccacgccg atagccatgc cggccccgac actgcgccaa       120
     ggcactgaaa atagggcaaa aacagttccg cgtgaaacgg gggaacgctc gcccgtcggc       180
     gctccgcccg tcaagcatta tgcggacgac gactatcggg cgatcgggac cgagcccttc       240
     tgggccgtga cggtgaacgg atcgaccgcc gtgctggaac gtccggacaa ggcgcccgtc       300
     cgctacgcca taacccgcaa cgacgacaag cgggcgctcc gtttcctggg cgagggtttt       360
     tccatgaccg taaccgaggg accatgcagc gacggcatga gcgatgcgct atggtcggat       420
     cgcgtggcgg tggcctttgg cgaagggact ctgaacggct gtggcggcct gagggacgat       480
     ctggacgagc cgtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page