(data stored in ACNUC7421 zone)

EMBL: AP010803.PE450

AP010803.PE450       Location/Qualifiers
FT   CDS_pept        460271..461281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95284"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY52"
FT                   /protein_id="BAI95284.1"
FT                   /translation="MALDYASAVRAGAMAAGRLHRQLSTREVIEQQGGNVDVFGAIHAV
FT                   DLPLLLRPLKGLLGAYLSDPAHGVLVTTERPMSIQRFTAAHELGHFSMQHQPSLDDESI
FT                   LRRMPTSPEPGGLFQETEADAFAIAFMMPKWLILSHSARQDWQVDDFRRANVVYQLSLR
FT                   LGASYEATCRTLLRYNLISQSTMTDLLRTQPRALKIDLLKDYRPANYRGDVWLLTERDA
FT                   GTRIDGSRNDLFVLRLKEHSGGGYLWDFDQLIASGFAIVRDDREAVDADAIGGPVVRRV
FT                   TAAIEAAQRGRMSIEERRPWQPVPALAHLTFDFDLTGPEPEGLSRAERRHLLEAA"
     atggcgctcg actacgcgag cgcggttcga gccggggcca tggccgctgg gcggctgcat        60
     cggcagctga gcacgcgcga agtgatcgaa cagcaaggtg gcaacgtcga tgtgttcggc       120
     gcgatccacg ccgtcgacct gccgttgttg ctccggccgc tcaaagggct gctcggcgcc       180
     tatttgagcg atcctgcgca cggcgtcctc gttacgaccg agcggccgat gagcattcag       240
     cgcttcacgg cggcccacga gctggggcat ttctcgatgc agcatcaacc cagccttgat       300
     gacgaaagca tcttgcggcg gatgccaaca tcgccggagc ccggagggct gttccaggaa       360
     accgaggcgg acgcctttgc gattgccttc atgatgccga aatggctgat cctgtcgcac       420
     agcgcccgcc aggattggca ggtcgatgat tttcgccgcg ccaacgtggt ttatcagctc       480
     tcgcttcgct tgggcgccag ctacgaagcg acatgccgga cgctgctgcg ctacaatctg       540
     atctcgcaat cgaccatgac cgatctgttg cggacgcagc cgcgcgcgct gaagatcgat       600
     cttctcaagg attatcgccc ggccaattat cgcggcgatg tctggcttct gaccgaacgc       660
     gacgctggca cgagaatcga tggcagccgc aacgacctgt ttgtgctccg gctcaaggaa       720
     catagcggcg gcgggtatct gtgggatttc gaccagctta tcgcgagcgg cttcgccatt       780
     gttcgcgacg accgcgaagc ggtcgatgcg gacgcgattg gcgggccggt cgttcggaga       840
     gtgacagccg ccatcgaggc ggcgcagcgg ggtcggatgt cgatcgagga acggcggcca       900
     tggcagccgg tgccagcgtt ggcccatctg acgttcgact tcgacctgac cggccccgaa       960
     cctgaaggtc tctcgcgcgc cgagcggcgg catctgctcg aggccgccta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page