(data stored in ACNUC7421 zone)

EMBL: AP010803.PE452

AP010803.PE452       Location/Qualifiers
FT   CDS_pept        461939..462718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95286"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY54"
FT                   /protein_id="BAI95286.1"
FT                   /translation="MYLPVPSQPDCVSAWREAVRVVDGAPGHQAYNVIIDVADPSARAT
FT                   LADPVVAEVDAFLAGRGKKPIETVANTIFPAALYHRHGAPLFFDRFRDNVLPKVRLKEA
FT                   WSGYYFERMMQLPQLDGPPINQIWGIVERLRNPKVRALNKFELSVFDPARDVNDSPYGG
FT                   QCLSFASLKLIGKGDQRRIAMTAFYRNHFYIEKLLGNLIGLGRLQSFIAKEGGVGLGPM
FT                   TIVSTHAEIDTGKWNRGDLQQLFARCDQASAQLLAAA"
     atgtatcttc cagtaccctc gcagcctgac tgcgtttccg cgtggcgcga ggcggtgcgc        60
     gtcgtcgatg gcgcccccgg ccaccaagcc tacaacgtca tcatcgacgt cgccgatccc       120
     tcggcgcgcg cgacgcttgc agatcccgtg gtcgccgagg tcgatgcctt ccttgccggg       180
     cggggcaaaa agccgatcga gacggtcgcc aacaccatct ttccggcagc gctctaccac       240
     cgccacggcg cgccgctctt cttcgatcgg ttccgggaca atgtgcttcc aaaggtcagg       300
     ttgaaggaag cctggtcagg ctactatttc gagcgaatga tgcagttacc ccaacttgac       360
     gggccgccga tcaaccagat ttgggggatc gtcgagcgcc tgcgcaatcc aaaggtgcgc       420
     gcgctcaaca agtttgaact gagcgttttc gaccctgccc gcgacgtgaa cgattcgcct       480
     tacggcgggc agtgtctgag cttcgcgagc ctcaagctga tcggcaaagg cgatcaacgc       540
     cggatcgcca tgacggcatt ctaccgcaac catttctaca tcgaaaagct actgggcaat       600
     ctgattgggc tgggcaggtt gcaatcgttc attgccaaag agggaggggt cggtctcgga       660
     ccaatgacaa tcgtctctac ccacgccgaa atcgacaccg gcaaatggaa tcgcggcgat       720
     ctccagcagc tttttgcgcg ctgcgatcag gcgagtgcgc aactcctcgc ggcagcataa       780
//

If you have problems or comments...

PBIL Back to PBIL home page