(data stored in SCRATCH zone)

EMBL: AP010803.PE453

AP010803.PE453       Location/Qualifiers
FT   CDS_pept        complement(462685..463389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95287"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY55"
FT                   /protein_id="BAI95287.1"
FT                   /translation="MTPKHFVSTLAATELPSVFNPWRDRCAVHDRRDAAAKRRDNLERL
FT                   LIAALDAKVETIWIARDLGYRGGRRTGVPLTDEVHLDRAGALMGGIALQRATQGPAVAE
FT                   RTAAIVWRVLEQIGQPVMLWNVFPFHPHEAGDPLSNRCHTRGEREATWPLLQALIAMLN
FT                   PRRIVAIGRDAHLALGDVGIPTTAVRHPSYGGQRDFIEGMFAMYGIDGGALETPRLPLE
FT                   APYAAARSCALA"
     atgaccccca agcatttcgt ttctactctg gcggcaaccg aacttccttc cgttttcaat        60
     ccctggcgcg atcgctgcgc cgttcatgac cggcgcgacg cggcggccaa gcggcgcgat       120
     aatctggaac ggttgctgat cgctgccttg gatgcaaagg tcgagaccat ctggattgcc       180
     cgcgacctcg gttatcgcgg tggccggcgc acgggcgttc ccctcaccga tgaggtccat       240
     ctcgaccggg cgggtgcgtt gatgggcggc atcgcccttc aacgtgcgac gcaaggcccg       300
     gcggtcgccg agcggacggc ggcgatcgtc tggcgcgtgc tcgaacagat cggacagccg       360
     gtcatgctct ggaacgtctt cccgttccat ccgcatgaag cgggcgatcc cttgtcgaac       420
     cgttgtcata cccgcggaga acgcgaggcg acctggcctt tgcttcaagc gctgattgcc       480
     atgctcaacc cccggcgcat cgttgcgatc gggcgcgatg ctcacctagc ccttggcgat       540
     gtcggtatac cgacgacggc cgtccgccat ccgagctatg gcgggcagcg cgacttcatc       600
     gaaggcatgt tcgcgatgta cgggatcgac ggtggcgctc tcgaaacgcc gcgtctgccg       660
     ttggaggcgc cttatgctgc cgcgaggagt tgcgcactcg cctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page