(data stored in ACNUC7421 zone)

EMBL: AP010803.PE455

AP010803.PE455       Location/Qualifiers
FT   CDS_pept        complement(464564..464698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95289"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY57"
FT                   /protein_id="BAI95289.1"
FT                   /translation="MTKRDLGQRALDAREPIRMIVLRALEAYGVNVPPEAISDRRKRN"
     gtgaccaagc gcgatcttgg tcagcgagcg ctcgacgctc gcgaacccat ccgcatgatc        60
     gtgctgcgcg cgctcgaggc ctacggcgta aatgtgccgc ctgaggcaat ctccgaccgt       120
     cggaagcgca actaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page