(data stored in ACNUC7421 zone)

EMBL: AP010803.PE462

AP010803.PE462       Location/Qualifiers
FT   CDS_pept        complement(471443..471784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95296"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY64"
FT                   /protein_id="BAI95296.1"
FT                   /translation="MTFPFPRISASSFRRSVACLVGGLAVLGVAGCASGPKKLAVCNGH
FT                   RLRDVNIYGSVLPGSPVPATTAPRVAPPIPPLSHPRDGDPPPPPAVPSPSTSDDKVSFA
FT                   PRGSHYASC"
     atgactttcc cttttccgcg aatttccgcc tcgagcttcc gccgcagcgt cgcttgccta        60
     gtcggtggct tagctgtgct cggcgtcgcg ggctgtgctt ccggacccaa gaagctcgcg       120
     gtttgcaatg gtcatcgcct gcgagacgtg aacatctacg gaagcgtcct gcctggctcg       180
     ccagtgcctg ccaccacggc accaagagtt gcgccgccca taccgcccct gtcccatcct       240
     cgagacggcg atccgccccc gccgcccgcc gtgccgtcgc cgtctacctc ggacgacaag       300
     gtctcgttcg caccaagggg atcgcattat gcgagctgct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page