(data stored in ACNUC7421 zone)

EMBL: AP010803.PE469

AP010803.PE469       Location/Qualifiers
FT   CDS_pept        complement(477443..477781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95303"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY71"
FT                   /protein_id="BAI95303.1"
FT                   /translation="MQRAIFGMAMLALATALPSAPAAANDLGCQVLLCLSNPGGATQYA
FT                   QCVSPMTQLWQRLATGGAFPGCSGGVARTKVYDRDSTTRRRVVITFNDGRSQTFSLAGI
FT                   ERLDGGRR"
     atgcaacgtg caatattcgg catggcgatg ctcgccctcg ccacagccct tccaagcgca        60
     ccggcagcgg cgaatgacct gggctgccag gttctcctgt gtctttccaa tcccggtggc       120
     gcgacccaat acgcgcaatg cgtgtcgccg atgacccagc tatggcaacg cttggccacc       180
     ggcggcgcct ttcccggctg tagcggcggc gtcgcccgca cgaaggtcta tgatcgcgat       240
     tccacaactc gccgccgggt ggtcatcacg ttcaacgacg gccgcagcca gaccttctcg       300
     ctggccggca tcgagcgttt ggacggcggc cgccgatga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page