(data stored in ACNUC7421 zone)

EMBL: AP010803.PE470

AP010803.PE470       Location/Qualifiers
FT   CDS_pept        complement(477845..478777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95304"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY72"
FT                   /protein_id="BAI95304.1"
FT                   /translation="MATIAPRGVSAATKADENLRQHGFCILRDVESRSRIEEINRSLHP
FT                   RFAATPFCQGGFYGPRTKRFGGLLKRAPTVESLVQNPAVMRLVHAILEPWCDTVQLNLT
FT                   QALELHPGAPAQFPHRDQDMWRGPTGELEYLVNVMWPISPFKAENGATLVWPGSHNGGQ
FT                   GDDGAEPVAIEADPGSAIIFLGSTLHGAGANRSNAVRRGIIVSYCLGWLKPYENQWLTY
FT                   PPEVASAFDPELAALVGYQQHRPNLGNYDGQCPSILLGGDPPDHLAAIDALRPDQEGAL
FT                   SEFLRQQTDQLPPRLGGLPKSSAVGTKER"
     atggccacga tcgcaccgcg cggcgtctcc gccgcgacca aagccgacga aaatctgcgg        60
     cagcacggct tctgcatcct gcgggatgtc gagtctcggt cacgcatcga ggagatcaat       120
     cgatccctcc atccgcgttt tgccgccacg cctttctgcc agggcggatt ctacggccct       180
     cggacaaaac gcttcggtgg cctgctgaag cgcgcgccga cggttgaaag tcttgtccaa       240
     aaccctgccg tcatgcgcct cgtccacgct atcctcgagc cctggtgcga cacggtccag       300
     ctcaacctca cgcaagcgct cgagctgcac ccgggggcgc cagcgcaatt tccgcaccgg       360
     gatcaggaca tgtggcgcgg tccgaccggc gagctcgaat atctcgtcaa cgtcatgtgg       420
     ccgatttcgc cgttcaaggc cgaaaatggg gcgacgctgg tctggccggg gagccacaat       480
     ggcgggcagg gcgacgacgg cgcggagccg gtcgccatcg aagcggatcc gggatcggcg       540
     atcatattcc tgggatcgac cctccatggc gccggcgcga atcgttcaaa cgcggtgcgc       600
     cgaggcatca tcgtcagcta ctgcctcggc tggctgaagc cctatgagaa ccagtggctg       660
     acctatccgc ccgaggtggc cagcgcattc gatcccgagc ttgccgcgct ggtcggctac       720
     cagcagcacc gccccaatct cggcaattat gacgggcagt gcccgtccat cctgctcggc       780
     ggcgatccgc cagaccatct cgccgcaatc gatgctctcc ggcccgacca ggaaggcgct       840
     ctgtccgaat tcctgcggca gcaaaccgat caactccccc cccggctagg gggattgccg       900
     aaatcgagcg cggtcggaac aaaagagagg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page